SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 430066.BAbS19_I02270 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  430066.BAbS19_I02270
Domain Number 1 Region: 115-358
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.21e-73
Family D-glucarate dehydratase-like 0.0000609
Further Details:      
 
Domain Number 2 Region: 3-129
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.09e-31
Family Enolase N-terminal domain-like 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 430066.BAbS19_I02270
Sequence length 372
Comment (Brucella abortus S19)
Sequence
MARIERFELRMVDLPPKAKRTDAIQSFVSQETPIVTITDSDGAVGTGYSYTIGTGGSSVM
RLLADHLAPLVIGEDADCIEAIWRRLEFATHATTIGAITALALAAIDTALWDLRAKKQNL
PLWKLAGGARDHCPLYTTEGGWLHIEKEALVEDALQAKAKGFTGSKIKIGKPHGAQDYAR
LSAVRAAVGAAFEIMTDCNQGFMVDEAIRRAERLKELDLAWIEEPLPADDLDGHMRLARS
TATPVAVGESIYSIRHFREYMHKGACSIVQVDVARIGGITPWLKVAHMAEAFDIPVCPHF
LMELHVSLVCAVPNGRYVEYIPQLDDLTDKGMEIRDGHAVAPSQPGIGIAWDWDAVRSRS
IGEFTREIVRAP
Download sequence
Identical sequences A0A0F6ANY1 A0A0M1WD00 A0A2K4NHP3 C4IN99 D7H1E6 Q2YP94 Q57FE3
gi|62289209|ref|YP_221002.1| gi|82699146|ref|YP_413720.1| 262698.BruAb1_0234 359391.BAB1_0242 430066.BAbS19_I02270 gi|189023480|ref|YP_001934248.1| WP_002965486.1.100443 WP_002965486.1.101965 WP_002965486.1.102082 WP_002965486.1.10322 WP_002965486.1.10630 WP_002965486.1.10893 WP_002965486.1.11620 WP_002965486.1.12041 WP_002965486.1.12241 WP_002965486.1.13460 WP_002965486.1.13826 WP_002965486.1.14542 WP_002965486.1.14633 WP_002965486.1.15077 WP_002965486.1.16975 WP_002965486.1.17378 WP_002965486.1.18034 WP_002965486.1.18635 WP_002965486.1.19641 WP_002965486.1.20012 WP_002965486.1.22583 WP_002965486.1.2337 WP_002965486.1.24196 WP_002965486.1.24428 WP_002965486.1.24655 WP_002965486.1.24726 WP_002965486.1.25101 WP_002965486.1.25382 WP_002965486.1.25729 WP_002965486.1.26599 WP_002965486.1.2778 WP_002965486.1.2839 WP_002965486.1.2874 WP_002965486.1.2877 WP_002965486.1.28889 WP_002965486.1.32337 WP_002965486.1.32492 WP_002965486.1.32731 WP_002965486.1.33220 WP_002965486.1.33599 WP_002965486.1.33753 WP_002965486.1.34353 WP_002965486.1.35056 WP_002965486.1.35970 WP_002965486.1.37797 WP_002965486.1.38353 WP_002965486.1.39021 WP_002965486.1.39039 WP_002965486.1.39963 WP_002965486.1.40407 WP_002965486.1.40624 WP_002965486.1.40649 WP_002965486.1.40871 WP_002965486.1.41044 WP_002965486.1.41311 WP_002965486.1.42103 WP_002965486.1.42427 WP_002965486.1.4428 WP_002965486.1.45559 WP_002965486.1.46182 WP_002965486.1.46432 WP_002965486.1.4727 WP_002965486.1.47558 WP_002965486.1.47610 WP_002965486.1.4847 WP_002965486.1.49640 WP_002965486.1.50051 WP_002965486.1.50053 WP_002965486.1.50282 WP_002965486.1.5052 WP_002965486.1.5236 WP_002965486.1.53481 WP_002965486.1.5394 WP_002965486.1.54440 WP_002965486.1.55440 WP_002965486.1.55684 WP_002965486.1.56334 WP_002965486.1.56952 WP_002965486.1.57925 WP_002965486.1.58525 WP_002965486.1.58539 WP_002965486.1.59086 WP_002965486.1.59515 WP_002965486.1.61325 WP_002965486.1.61536 WP_002965486.1.61997 WP_002965486.1.63730 WP_002965486.1.64124 WP_002965486.1.64853 WP_002965486.1.64905 WP_002965486.1.65131 WP_002965486.1.65454 WP_002965486.1.65625 WP_002965486.1.66260 WP_002965486.1.66810 WP_002965486.1.67893 WP_002965486.1.67996 WP_002965486.1.67997 WP_002965486.1.68913 WP_002965486.1.69451 WP_002965486.1.69829 WP_002965486.1.70322 WP_002965486.1.71689 WP_002965486.1.71846 WP_002965486.1.7206 WP_002965486.1.72916 WP_002965486.1.75458 WP_002965486.1.75766 WP_002965486.1.76350 WP_002965486.1.76433 WP_002965486.1.77321 WP_002965486.1.78109 WP_002965486.1.7984 WP_002965486.1.79963 WP_002965486.1.80266 WP_002965486.1.80476 WP_002965486.1.80697 WP_002965486.1.81617 WP_002965486.1.81822 WP_002965486.1.8224 WP_002965486.1.8307 WP_002965486.1.85322 WP_002965486.1.85769 WP_002965486.1.8657 WP_002965486.1.87522 WP_002965486.1.87603 WP_002965486.1.87867 WP_002965486.1.8788 WP_002965486.1.8878 WP_002965486.1.90689 WP_002965486.1.91123 WP_002965486.1.91338 WP_002965486.1.92518 WP_002965486.1.93454 WP_002965486.1.94126 WP_002965486.1.94555 WP_002965486.1.94775 WP_002965486.1.97511 WP_002965486.1.97741 WP_002965486.1.98076 WP_002965486.1.98455 WP_002965486.1.99221 WP_002965486.1.99373 WP_002965486.1.99421 gi|376271847|ref|YP_005150425.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]