SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 431943.CKL_1396 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  431943.CKL_1396
Domain Number 1 Region: 6-164
Classification Level Classification E-value
Superfamily RNase III domain-like 1.29e-47
Family RNase III catalytic domain-like 0.0000319
Further Details:      
 
Domain Number 2 Region: 157-235
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 4.56e-22
Family Double-stranded RNA-binding domain (dsRBD) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 431943.CKL_1396
Sequence length 244
Comment (Clostridium kluyveri DSM 555)
Sequence
MEKVNFFEEVEKTLNISFNDKELIDTALTHSSYANGKKGVKFNERMEFLGDSVLQLCISE
YLFLIYKSKSEGELTKKRSLIVCENSLYEVAKKWNIGKYIKMSKGEEITGGRERTSILAN
CVEAIIAAIYIDSGYKKTKQFIIDNFKDIIEKAIKNQIVLDYKTNLQEIVQQDGDIHIEY
MLIKYEGPPHRRKFYTKVCVANNVMGSGVGYTKKESEQNAAQDALKKLKSEDKWNKEGID
TNEK
Download sequence
Identical sequences A5N807 B9E1G8
gi|219854635|ref|YP_002471757.1| 431943.CKL_1396 583346.CKR_1292 gi|153954021|ref|YP_001394786.1| WP_012101785.1.77168 WP_012101785.1.89246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]