SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 431947.PGN_1125 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  431947.PGN_1125
Domain Number 1 Region: 85-146
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000353
Family NfeD domain-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 431947.PGN_1125
Sequence length 154
Comment (Porphyromonas gingivalis ATCC 33277)
Sequence
MLFESITPVQWWLIAGILLFVFEIFTPGFFLACFGMGAFAAIIPAALGLSIVWQTVFFIV
ASLLSLFLLRPFMQKRAQKALPHVSTGADALVGRKVLVTETIDPTTDKGRVAVDGDVWTA
RSLTGEVIEKGMRVEIVSYESIVLNVVVLGNDKQ
Download sequence
Identical sequences A0A0E2LRQ4 A0A212G950 A0A2D2P5N0 B2RJU9 Q7MUY7 W1R919
GO.2716 242619.PG1335 431947.PGN_1125 gi|334147913|ref|YP_004510842.1| gi|188994989|ref|YP_001929241.1| WP_010956285.1.10894 WP_010956285.1.15631 WP_010956285.1.17731 WP_010956285.1.19526 WP_010956285.1.22258 WP_010956285.1.22416 WP_010956285.1.22673 WP_010956285.1.27553 WP_010956285.1.27924 WP_010956285.1.35527 WP_010956285.1.39476 WP_010956285.1.39500 WP_010956285.1.45699 WP_010956285.1.48852 WP_010956285.1.58990 WP_010956285.1.6507 WP_010956285.1.68188 WP_010956285.1.73823 WP_010956285.1.79666 WP_010956285.1.80580 WP_010956285.1.99224 WP_010956285.1.99922 gi|34541025|ref|NP_905504.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]