SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 434922.CBUD_0527 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  434922.CBUD_0527
Domain Number 1 Region: 39-218
Classification Level Classification E-value
Superfamily ClpP/crotonase 5.66e-26
Family Clp protease, ClpP subunit 0.09
Further Details:      
 
Domain Number 2 Region: 391-456
Classification Level Classification E-value
Superfamily NfeD domain-like 2.48e-16
Family NfeD domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 434922.CBUD_0527
Sequence length 458
Comment (Coxiella burnetii Dugway 7E9-12)
Sequence
MYCRKRIFIRRFYILMLTFGLLGIASHIIAQNNTRRLAILIDIKGGIGPATADFFHRSLK
QATEKKAQVIILQLDTPGGLATAMRDIIKDILASPIPVIGYVAPSGAHAASAGTYILYAT
HIAAMAPGTNLGAATPIAIGTPGGSSPEKGNEKKEGAKKAPAQKTAAEKKAISDARAYIR
SLAQLRGRNVEWAESAVVEAESLSAEEAYKIKVINIIASNIPNLLEQANGMKISVRGETQ
TVNTANLEIEKVEPDWRTRFLSVITDPSVAYILLMIGFYGIFFEFINPGFIVPGVVGAIS
LLLALYAFQLLPINYAGLALILLGLAFIVAEAFMPSFGMLGIGGGVAFVIGSIMLMRTDA
IGFGIPMYLIIAIAIVTIAFFLLVLSMAFRSRGRPIVSGREAVIGKRGVVNVSDKRMWVR
IEGERWQCKSDVPLQDGDEVVVERLEGLFCVVKPVEKK
Download sequence
Identical sequences A9KBI9
WP_011996612.1.29693 WP_011996612.1.43615 WP_011996612.1.99156 gi|154707166|ref|YP_001423941.1| 434922.CBUD_0527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]