SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 434922.CBUD_0621 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  434922.CBUD_0621
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.2e-41
Family GHMP Kinase, N-terminal domain 0.00039
Further Details:      
 
Domain Number 2 Region: 198-320
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00000000000151
Family Mevalonate kinase 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 434922.CBUD_0621
Sequence length 340
Comment (Coxiella burnetii Dugway 7E9-12)
Sequence
MKKEFLKTRTPAKLILSGEHAVVYGHPALSVAINRYMEATVRWSLPLHFSFHFMGIDFRR
EVTLQALRNLKRKLKKQYHKYSLGHLSIREVLQKPFELSLFTFINVLDRLKNKLPTGIDI
VTDSNIPVGCGMGSSAASVVSLIYVLTQFLGMDLHLEDYLSLGVESENLQHGYSSGLDVH
TVYHGGCLRYEKGQFEKRPIPDFPMQLIQTGCPQSSTGECISEAAPFFKNSKIGEDFSAV
TNALDQALQNHNNDSIKGCIRENHRLLRSIGVVPDKVNNFVIDVEKLGGAAKICGAGSVV
GDNGGIVLVIADDLITDLAKQYGYSIIPIQTDSQGTCIIE
Download sequence
Identical sequences A9KC30
434922.CBUD_0621 WP_011996656.1.29693 WP_011996656.1.43615 WP_011996656.1.99156 gi|154707263|ref|YP_001424028.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]