SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 434923.CbuG_0347 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  434923.CbuG_0347
Domain Number 1 Region: 144-423
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.73e-199
Family SCOPe 0.0000014
Further Details:      
 
Domain Number 2 Region: 4-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 8.13e-94
Family SCOPe 0.0000973
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 434923.CbuG_0347
Sequence length 428
Comment (Coxiella burnetii CbuG Q212)
Sequence
MTATITDINAHEILDSRANPTLEVRVTLSSQAYGCAAVPSGASTGEREAVELRDNDLERY
GGKGVLQAVENVNGPIRDALLGQDPRSQEEIDRIMIELDGTENKANLGANAILGVSLAVA
YAAANNADLPLYRYLGGDGGPFSMPVPMMNIINGGAHATNNLDFQEFMIVPVGAPTFAEA
LRYGAEVFHALKKRLVSRGLMSAVGDEGGFAPDLPNNEAAFELILEAIEDANYVPGKDIY
LALDAASSELYQNGRYDFENNQLTSEEMIDRLTEWTKKYPVISIEDGLSENDWAGWKLLT
ERLENKVQLVGDDIFVTNPDILEKGIKKNIANAILVKLNQIGTLTETLATVGLAKSNKYG
VIISHRSGETEDTTIADLAVATDARQIKTGSLCRSDRVAKYNRLLQIERELNDQAPYAGK
EAFLFNRK
Download sequence
Identical sequences A0A2K2EA02 A9N9U9 B6J3X4 B6J4X4 Q83B44
227377.CBU_1674 360115.COXBURSA331_A1865 434923.CbuG_0347 434924.CbuK_0336 gi|161830114|ref|YP_001597503.1| gi|212211990|ref|YP_002302926.1| NP_820656.1.72601 WP_005770583.1.11896 WP_005770583.1.15899 WP_005770583.1.18645 WP_005770583.1.18990 WP_005770583.1.20088 WP_005770583.1.25364 WP_005770583.1.31144 WP_005770583.1.35092 WP_005770583.1.38839 WP_005770583.1.39746 WP_005770583.1.41753 WP_005770583.1.44545 WP_005770583.1.460 WP_005770583.1.513 WP_005770583.1.53098 WP_005770583.1.55037 WP_005770583.1.55635 WP_005770583.1.56161 WP_005770583.1.57074 WP_005770583.1.6787 WP_005770583.1.68745 WP_005770583.1.68840 WP_005770583.1.72017 WP_005770583.1.7296 WP_005770583.1.73073 WP_005770583.1.74283 WP_005770583.1.85884 WP_005770583.1.88235 WP_005770583.1.8942 WP_005770583.1.92481 WP_005770583.1.96664 WP_005770583.1.9866 gi|212217996|ref|YP_002304784.1| gi|29654964|ref|NP_820656.1| 3tqp_A 3tqp_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]