SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 435590.BVU_2274 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  435590.BVU_2274
Domain Number 1 Region: 1-191
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.92e-39
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 435590.BVU_2274
Sequence length 193
Comment (Bacteroides vulgatus ATCC 8482)
Sequence
MRKDIILSGVGGQGILTIATIIGEAATAEGINLKQAEVHGMSQRGGDVQSNLRLSDETIY
SDLIAQGEADLIISMEPMEALRYLPYLQEEGWVITSANPFKNIPDYPEEVDLMRALESLP
HVVKLEIEDMAKENSMPKCANVILLGMAAKYIEIVSPEQLRESIGRVFAAKGEKIVEMNQ
KAFDIGLNAVKNW
Download sequence
Identical sequences A0A069SUW2 A0A078R9L2 A0A0M4BL77 A0A174P1Q8 A0A1Q6G2T8 A6L2L9 C6Z4G0 D4VCS3 E5UU86 I9A2P9 R7P5U0 R9HPZ3
435590.BVU_2274 gi|150004811|ref|YP_001299555.1| APC36298 WP_005846114.1.102092 WP_005846114.1.15823 WP_005846114.1.15915 WP_005846114.1.18028 WP_005846114.1.20075 WP_005846114.1.20211 WP_005846114.1.25291 WP_005846114.1.34002 WP_005846114.1.47352 WP_005846114.1.56832 WP_005846114.1.6673 WP_005846114.1.72715 WP_005846114.1.8648 WP_005846114.1.97168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]