SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 435591.BDI_2115 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  435591.BDI_2115
Domain Number - Region: 102-154
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00732
Family NfeD domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 435591.BDI_2115
Sequence length 162
Comment (Parabacteroides distasonis ATCC 8503)
Sequence
MLLDIAIIVFLMVAAILLILAEIFLLPGITLAGIGGAIFAIGGVVFAYTVGMWVGHLTLS
LSIIAFGVIFAWLLRSRSFNKIALKTDIDSKLTSSRDLGIEPGDEGITLSRLAPIGKARI
KGINVEAKSQDELIDENTPIVVIRVDSYNVIVRPKEETNIHA
Download sequence
Identical sequences A0A073I4C3 A0A078SQU5 A0A223HR75 A0A2J9HR86 A6LDT2 C7XC60
gi|150008725|ref|YP_001303468.1| WP_005854362.1.47855 WP_005854362.1.52717 WP_005854362.1.61673 WP_005854362.1.86952 WP_005854362.1.87144 WP_005854362.1.98975 435591.BDI_2115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]