SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 435591.BDI_2807 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  435591.BDI_2807
Domain Number 1 Region: 239-498
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.9e-57
Family Pyruvate oxidase and decarboxylase Pyr module 0.075
Further Details:      
 
Domain Number 2 Region: 15-217
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.53e-18
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.013
Further Details:      
 
Domain Number 3 Region: 507-614
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000000000000157
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 435591.BDI_2807
Sequence length 617
Comment (Parabacteroides distasonis ATCC 8503)
Sequence
MAEQTKVKTLEKVVIRFSGDSGDGMQLTGTIFSNLSAVFGNEISTFPDYPAEVRAPQGTL
SGVSGFQVHLGSRKIFTPGDKADVLVAMNPAALKVNVKHLKPNAIVLIDTDSFKKSDLDK
ALFTTDDPFTELGLTGVQVVAAPISTMVKDGLVEFGLDNKSALRCKNMFALGLVCWLFER
PLEEAMHMLQNKFAKKPVIAQANIKALTDGYNYGNNIHASVSTYRIESKKAEPGFYTDVN
GNKATSYGLIAAAEKAGLQLFLGSYPITPATDILHELSKRKDLGVITVQAEDEIAGICTS
IGASFAGCLAATSTSGPGLALKSEAIGLAVIAELPLVIIDVQRGGPSTGLPTKSEQTDLM
QALYGRNGESPAVVIAASTPTDCFDAAFWAGKLAVEHMTPVILLTDAFIANGSSAWRIPE
MDKYPEIKPNYVANYQDEKVWKAYRRNKESLVRYWAIPGTEGFAHRLGGLEKDYETSAIS
TDPANHQKMVTTRQAKIDKIADYIPELEVIGDEDADLLIVGWGGTYGHLYETMETMQENG
KKVAFAHFKFINPLPKNTAEVLSKYKKVVVAEQNNGQFANYLRGKVPGFNPYRFNRVKGQ
PFVVARLVEEFTKILEA
Download sequence
Identical sequences A0A069RXG7 A0A073ICV4 A0A173VV17 A0A1Q6FBQ9 A0A223HSW3 A6LFQ6 C7XFH1 D7IX27 E1Z1A9 K5ZRR6
435591.BDI_2807 gi|150009399|ref|YP_001304142.1| WP_005860728.1.12386 WP_005860728.1.27322 WP_005860728.1.34635 WP_005860728.1.38556 WP_005860728.1.47855 WP_005860728.1.61673 WP_005860728.1.725 WP_005860728.1.80225 WP_005860728.1.87144 WP_005860728.1.90444 WP_005860728.1.94048 WP_005860728.1.98975 WP_005860728.1.99689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]