SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 436308.Nmar_0413 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436308.Nmar_0413
Domain Number 1 Region: 241-501
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.01e-53
Family PFOR Pyr module 0.063
Further Details:      
 
Domain Number 2 Region: 521-628
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5.63e-20
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.064
Further Details:      
 
Domain Number 3 Region: 6-222
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000000000288
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 436308.Nmar_0413
Sequence length 636
Comment (Nitrosopumilus maritimus SCM1)
Sequence
MSSTDFTWLIGGPQGSGVESGANIFSRVCAEMGYQVFGKREFYSNIKGEHSYFAVRISDE
KIHSNVNDVTLMASFDAETIFRHYDEVVSDGGIIYDADLDDVTTDRVHTLDAPFRERLHK
KLESKNKPFSIAGVLEIAKENGVKLYPVSFKSILETLAEETENPRLKGLVRMFNVIGVSL
SLGLVKMPPDSLQKTIGTIFSKKQEIAKINQQTANYSYNYATAKFEDFHHTLTGIQKESG
TLLVQGFQGTALGKMACGCRVQPYYPITPASDESVFLESNEILEIIDDRPGSTAVIQTED
EICAMGMTIGSALTGTRSATCTSGPGFALMTEMLGWAGINEVPVVITNYQRSGPSTGLPT
RHGQDDLLFSVFAGHGDFPKIVYASGDVEESFYDTGNVFNYADIFQVPVIHLMDKFIASS
VVTCTRFDPSKITINRGKLLDKVEGEYERFAFTEDGVSPRSKLGLDNGIFWDTGDESDEK
GHITEDPVLRVKMMDKRMSRLDLILKEIPEAEKAVSFGVEDFTVITWGSSKGPIIDAIEM
LKKDGISIGLVQIKLLHPFPGDYVASLLKDAKTIIDVEANHSAQLGKLFKQNVQRDIDYS
ILKYTGRAMTSTEVYDSLKKIVENKAEKREVLMHGA
Download sequence
Identical sequences A9A5B0
gi|161527921|ref|YP_001581747.1| 436308.Nmar_0413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]