SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 436907.A7TEY1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436907.A7TEY1
Domain Number 1 Region: 145-434
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 9.17e-125
Family Enolase 0.000000000189
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.43e-58
Family Enolase N-terminal domain-like 0.000000445
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 436907.A7TEY1
Sequence length 437
Comment (Vanderwaltozyma polyspora DSM 70294)
Sequence
MAISKVYARSVYDSRGNPTVEVEVSTEKGVFRAMVPSGASTGIHEALEMRDEDKSKWLGK
GVMNAVNNVNNVIAPALIKANVDVKDQKAVDDFMIALDGTPNKSKLGANAILGVSLAVAR
AAAAEKNVPLYQHLADLSASKASPFVLPVPFLNVLNGGSHAGGALALQEFMIAPTGAPSF
SEALRMGSEVYHHLKSLTKKRYGSSAGNVGDEGGVAPNIQTAEEALDLIVDSIKLAGHEG
KIKIGLDCASSEFFKDGKYDLDFKNPESDPSKWLSGPELADMYHNLMKKYPIVSIEDPFA
EDDWEAWSHFFKTAGIQIVADDLTVTNPARIATAIEKKAADALLLKVNQIGSLTESIKAA
QDSFAAGWGVMVSHRSGETEDTFIADLVVGLRSGQIKTGAPARSERLAKLNQILRIEEEL
GDKAVYAGEKFHHGFQL
Download sequence
Identical sequences A7TEY1
tr|A7TEY1|A7TEY1_VANPO XP_001647085.1.22633 436907.A7TEY1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]