SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 436907.A7TTF6 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436907.A7TTF6
Domain Number 1 Region: 1-282
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.17e-120
Family Enolase 0.000000000279
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 436907.A7TTF6
Sequence length 285
Comment (Vanderwaltozyma polyspora DSM 70294)
Sequence
NVLNGGSHAGGALALQEFMIAPTGAPSFSEALRMGSEVYHHLKSLTKKRYGSSAGNVGDE
GGVAPNIQTAEEALDLIVDSIKLAGHEGKIKIGLDCASSEFFKDGKYDLDFKNPESDPSK
WLSGPELADMYHNLMKKYPIVSIEDPFAEDDWEAWSHFFKTAGIQIVADDLTVTNPARIA
TAIEKKAADALLLKVNQIGSLTESIKAAQDSFAAGWGCMVSHRSGETEDTFIADLVVGLR
SGQIKTGAPARSERLAKLNQILRIEEELGDKAVYAGENFHHGFQL
Download sequence
Identical sequences A7TTF6
436907.A7TTF6 tr|A7TTF6|A7TTF6_VANPO XP_001642313.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]