SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 438753.AZC_4274 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  438753.AZC_4274
Domain Number - Region: 94-144
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000902
Family NfeD domain-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 438753.AZC_4274
Sequence length 146
Comment (Azorhizobium caulinodans ORS 571)
Sequence
MSMLGDISPYWLWFAMGGVLLVAETIVPGAFLVWFGLAALATGLLSLVADMGWQGQVLAF
AGCAVVAVLIGRRIALRGGGTDRPFLNRRAEAQVGRVFTLEAPIADGAGHVRIDDSIWRI
SGPDLPAGAKVIVLRVEGTVLLVGPA
Download sequence
Identical sequences A8HV60
438753.AZC_4274 gi|158425898|ref|YP_001527190.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]