SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 439235.Dalk_1627 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  439235.Dalk_1627
Domain Number 1 Region: 4-174
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.19e-40
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 439235.Dalk_1627
Sequence length 193
Comment (Desulfatibacillum alkenivorans AK 01)
Sequence
MQKLEVIITGFGGQGIVLAGRILGQAASLGDHKESTLIQSYGPESRGGACSAQVIISDGT
INYPYVRQPDILAAMSQAGFDKFVDQVKPEGFILIDQDLVKPKGLDRDYFAVPSTRMAEE
LGRKMMANIIMIGFITAVTQASTLEATRETVTKSVPKGTEEMNIKAFSKGYDYGLSLLKA
RDKKASGQSGALA
Download sequence
Identical sequences B8FAM9
439235.Dalk_1627 WP_012610759.1.12191 gi|218779475|ref|YP_002430793.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]