SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 439235.Dalk_3751 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  439235.Dalk_3751
Domain Number 1 Region: 88-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000235
Family NfeD domain-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 439235.Dalk_3751
Sequence length 152
Comment (Desulfatibacillum alkenivorans AK 01)
Sequence
MIEAITSPILIWFIIGLALILAEFAVPGIILIFFGIGAWVVSAMCAVIDASLNTQLFVFL
ISSVLSLALLRTWVKKTFVGNAMDGESSFNSDELVGQKAVTVHEIKPGFTGKVEFRGTRW
NAVADELIEESQPVEIVKQDNLTLVVKPFKSN
Download sequence
Identical sequences B8FLT4
439235.Dalk_3751 gi|218781588|ref|YP_002432906.1| WP_015948489.1.12191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]