SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 439375.Oant_3341 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  439375.Oant_3341
Domain Number 1 Region: 97-121,153-382
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 9.3e-67
Family D-glucarate dehydratase-like 0.00036
Further Details:      
 
Domain Number 2 Region: 1-113
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 6.61e-30
Family Enolase N-terminal domain-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 439375.Oant_3341
Sequence length 399
Comment (Ochrobactrum anthropi ATCC 49188)
Sequence
MKITAIETVQLPHLNNIVWVQVHTDDGIVGLGETFRGANAVAAYIHSDIAPLLVGQNPLE
IDRISKLLLESYVGFRSSGVEIRAASAIDIALWDIFGKVTGQPIHQLLGGLSRQSIRTYN
TCAGYTYNKSGARRYIGDADEAKEGPYEDQLAFHRDAGALAESLLSEGITAMKIWPFDPF
AVASGGNFIHAGDLDKALAPFRQIRDAVGERMEIMVEFHSMWDLTSALAIARELKAFRPF
WSEDPIKMMNPQALAVYARQSGIPVCASETMATRAQFLDVLRADASDYVMLDISWCGGLS
EAKKIATMAEAFQRPIAPHDCTGPVVFAASVHLSLNAPNAIFQESVRAYYTSWYRDLVTV
MPRIEKGMIYPFEGAGLGLELSDFVFSHPDVIRKKTGAE
Download sequence
Identical sequences A6X493
WP_012092773.1.12014 WP_012092773.1.91370 gi|153010662|ref|YP_001371876.1| 439375.Oant_3341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]