SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 439375.Oant_4268 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  439375.Oant_4268
Domain Number - Region: 28-81
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00017
Family Glycerol-3-phosphate transporter 0.071
Further Details:      
 
Domain Number - Region: 94-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00745
Family NfeD domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 439375.Oant_4268
Sequence length 153
Comment (Ochrobactrum anthropi ATCC 49188)
Sequence
MIIEYLSGLGIWNWLVFGLILLILEISAPGFFFIWFGLAALVTGALAFLLSSTTGFGWQF
QTVVFLVLAVIFVLVGRRFFGSRSTDADEPLLNRRGEQLVGQRATLTEPIINGRGRIRIN
DTMWRVKGPDLPTGTEVRVVAFDPVSLEIEVAE
Download sequence
Identical sequences A6X6W4
439375.Oant_4268 gi|153011583|ref|YP_001372797.1| WP_012093559.1.12014 WP_012093559.1.91370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]