SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 439386.YG5714_0442 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  439386.YG5714_0442
Domain Number 1 Region: 110-355
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.14e-46
Family D-glucarate dehydratase-like 0.001
Further Details:      
 
Domain Number 2 Region: 2-127
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.59e-18
Family Enolase N-terminal domain-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 439386.YG5714_0442
Sequence length 376
Comment (Sulfolobus islandicus Y G 57 14)
Sequence
MKVKPFSLSIPFNTNPPSDWKDTWDVQLYVKVEDEEDYGWGETLVAGSGIINSYLSIIND
IVIPILSKVELTEPTDVRTILEKILFSAGNCGVVSGAISAVEMALWGLKARKSNVELTRL
IGGKVRDSVKVYASFPRFGKIDYIIIATRKSIERGFDLVKLHQSPSSVIDAVKAIRGNYK
EVKIAIDLNSPFDNLDKTKEFVDKVHKYEIEWVEEPLWPPNDYDLLSKLTEFSPIPIAAG
ENEYSLYGFKKMIESGITYLQPDIAKIGGVSKFLEILDLASKHKVRVLPHDRPDASPLSL
IYTLNLGLVKSQIEMVEYTIADFPNDLFYSLPKFKDGYIYPSENPEVIEENIEKYGYKNR
LRILHFSDLESKLTRK
Download sequence
Identical sequences C3NA48
WP_012715600.1.13477 gi|229578256|ref|YP_002836654.1| 439386.YG5714_0442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]