SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 439386.YG5714_1044 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  439386.YG5714_1044
Domain Number 1 Region: 3-127
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 1.18e-38
Family HEPN domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 439386.YG5714_1044
Sequence length 129
Comment (Sulfolobus islandicus Y G 57 14)
Sequence
MREEAEKWLRQALEDLATAKDTITTGHYYASAFWAEQAAEKALKALLIAGGKIERTHDLN
ELLEIIKEEIGLSVEEIRSEVIKLTLHYTISRYPDAANTIPYSLYSKEDAEELVKKAEKV
IEWVKRNLH
Download sequence
Identical sequences A0A157T265 C3MLP5 C3NDC6 D2PJ91 Q97XR7
gi|15898460|ref|NP_343065.1| 273057.SSO1641 429572.LS215_0536 439386.YG5714_1044 gi|284997447|ref|YP_003419214.1| gi|229578839|ref|YP_002837237.1| WP_010923542.1.13477 WP_010923542.1.34992 WP_010923542.1.43719 WP_010923542.1.66823 WP_010923542.1.8449 gi|227829509|ref|YP_002831288.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]