SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 439843.SeSA_A1607 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  439843.SeSA_A1607
Domain Number 1 Region: 98-388
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.7e-79
Family D-glucarate dehydratase-like 0.00017
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 9.87e-34
Family Enolase N-terminal domain-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 439843.SeSA_A1607
Sequence length 404
Comment (Salmonella enterica serovar Schwarzengrund CVM19633)
Sequence
MKIVGAEVFVTCPGRNFVTLKITTEDGITGLGDATLNGRELPVASYLTDHLCPQLIGRDA
RRIEDIWQFFYKGAYWRRGPVTMSAISAVDMALWDIKAKAANMPLYQLLGGASREGVMVY
CHTTGHTIDDVLEDYARHKEQGFKAIRVQCGVPGMKTTYGMAKGKGLAYEPATKGQWPEE
QLWSTEKYLDFTPKLFDAVRNTFGFNEHLLHDMHHRLTPIEAARFGKSIEDYRLFWMEDP
TPAENQACFRLVRQHTVTPIAVGEVFNSIWDCKQLIEEQLIDYIRTTLTHAGGITGMRRI
ADFASLYQVRTGSHGPSDLSPVCMAAALHFDLWVPNFGVQEFMGYSEQMLEVFPHNWTFE
GGYMHPGDKPGLGIEFDEKLAAKYPYDPAYLPVARLEDGTLWNW
Download sequence
Identical sequences A0A0L9F4N5 A0A0N1QW59 A0A1C3A386 A0A271CKG8 A0A2A6DFI9 A0A2D1XS09 A0A2I6M8J0 G5MIM3 G5RVI8
gi|194735816|ref|YP_002114521.1| ABEJ01000003|CDS_83990-85204 CP001127|CDS_1549710-1550924 WP_000706271.1.100714 WP_000706271.1.101147 WP_000706271.1.10164 WP_000706271.1.10293 WP_000706271.1.11479 WP_000706271.1.11603 WP_000706271.1.12282 WP_000706271.1.12877 WP_000706271.1.13799 WP_000706271.1.13827 WP_000706271.1.14296 WP_000706271.1.15054 WP_000706271.1.15795 WP_000706271.1.16804 WP_000706271.1.17270 WP_000706271.1.18277 WP_000706271.1.18365 WP_000706271.1.18489 WP_000706271.1.19174 WP_000706271.1.19405 WP_000706271.1.20760 WP_000706271.1.20810 WP_000706271.1.21260 WP_000706271.1.21473 WP_000706271.1.21730 WP_000706271.1.22069 WP_000706271.1.2283 WP_000706271.1.22966 WP_000706271.1.23053 WP_000706271.1.23444 WP_000706271.1.24303 WP_000706271.1.24412 WP_000706271.1.24450 WP_000706271.1.24521 WP_000706271.1.25397 WP_000706271.1.25708 WP_000706271.1.2667 WP_000706271.1.26833 WP_000706271.1.27055 WP_000706271.1.27655 WP_000706271.1.2806 WP_000706271.1.28116 WP_000706271.1.28174 WP_000706271.1.28921 WP_000706271.1.28963 WP_000706271.1.30225 WP_000706271.1.3066 WP_000706271.1.30934 WP_000706271.1.31262 WP_000706271.1.3185 WP_000706271.1.32357 WP_000706271.1.32643 WP_000706271.1.3304 WP_000706271.1.33144 WP_000706271.1.34022 WP_000706271.1.35035 WP_000706271.1.35075 WP_000706271.1.3610 WP_000706271.1.36792 WP_000706271.1.3688 WP_000706271.1.37100 WP_000706271.1.37363 WP_000706271.1.37719 WP_000706271.1.37808 WP_000706271.1.38797 WP_000706271.1.38857 WP_000706271.1.39059 WP_000706271.1.40205 WP_000706271.1.40583 WP_000706271.1.40693 WP_000706271.1.41994 WP_000706271.1.42356 WP_000706271.1.4332 WP_000706271.1.43654 WP_000706271.1.4422 WP_000706271.1.44339 WP_000706271.1.44380 WP_000706271.1.45154 WP_000706271.1.45402 WP_000706271.1.46499 WP_000706271.1.47014 WP_000706271.1.48647 WP_000706271.1.49090 WP_000706271.1.49778 WP_000706271.1.52456 WP_000706271.1.5273 WP_000706271.1.55680 WP_000706271.1.56069 WP_000706271.1.56413 WP_000706271.1.56642 WP_000706271.1.57495 WP_000706271.1.57778 WP_000706271.1.57857 WP_000706271.1.58251 WP_000706271.1.58334 WP_000706271.1.58633 WP_000706271.1.59012 WP_000706271.1.59295 WP_000706271.1.59755 WP_000706271.1.60469 WP_000706271.1.60851 WP_000706271.1.60857 WP_000706271.1.61737 WP_000706271.1.62108 WP_000706271.1.62488 WP_000706271.1.65538 WP_000706271.1.66250 WP_000706271.1.66702 WP_000706271.1.67175 WP_000706271.1.6883 WP_000706271.1.6905 WP_000706271.1.70087 WP_000706271.1.70281 WP_000706271.1.70355 WP_000706271.1.7044 WP_000706271.1.7093 WP_000706271.1.70986 WP_000706271.1.71088 WP_000706271.1.71150 WP_000706271.1.71450 WP_000706271.1.71583 WP_000706271.1.72438 WP_000706271.1.74428 WP_000706271.1.74469 WP_000706271.1.74757 WP_000706271.1.74876 WP_000706271.1.75134 WP_000706271.1.75168 WP_000706271.1.7531 WP_000706271.1.7657 WP_000706271.1.76611 WP_000706271.1.77761 WP_000706271.1.78180 WP_000706271.1.78789 WP_000706271.1.79189 WP_000706271.1.79778 WP_000706271.1.8024 WP_000706271.1.80496 WP_000706271.1.80707 WP_000706271.1.80803 WP_000706271.1.81118 WP_000706271.1.82352 WP_000706271.1.82562 WP_000706271.1.82637 WP_000706271.1.82899 WP_000706271.1.83247 WP_000706271.1.83388 WP_000706271.1.84115 WP_000706271.1.84229 WP_000706271.1.84325 WP_000706271.1.84403 WP_000706271.1.84523 WP_000706271.1.850 WP_000706271.1.85031 WP_000706271.1.85797 WP_000706271.1.86658 WP_000706271.1.86921 WP_000706271.1.89355 WP_000706271.1.90521 WP_000706271.1.90991 WP_000706271.1.91023 WP_000706271.1.91381 WP_000706271.1.91473 WP_000706271.1.92149 WP_000706271.1.92836 WP_000706271.1.92843 WP_000706271.1.94971 WP_000706271.1.94986 WP_000706271.1.96404 WP_000706271.1.97005 WP_000706271.1.97496 WP_000706271.1.98403 WP_000706271.1.99637 439843.SeSA_A1607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]