SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 439843.SeSA_A2499 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  439843.SeSA_A2499
Domain Number 1 Region: 109-395
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.26e-81
Family D-glucarate dehydratase-like 0.000000000186
Further Details:      
 
Domain Number 2 Region: 1-126
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.82e-32
Family Enolase N-terminal domain-like 0.000000321
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 439843.SeSA_A2499
Sequence length 400
Comment (Salmonella enterica serovar Schwarzengrund CVM19633)
Sequence
MKITSIEVFDCELKKRDQTMSSYNPVLIRVNTDSGLSGIGEVGLAYGAGAKAGVGIIRDL
APLIVGEDPLNIEKIWEFFFRKTFWGMGGGNVFYAGMSAIDIALWDIKGKYLGVPVYQLL
GGKTNEKLRTYASQLQFGWGDKRQILVTPDEYAEAARAALDDGYDAIKVDPLEIDRNGDD
CVFQNKNRNYSGLLLADQLKMGEARIAAMREAMGDDADIIVEIHSLLGTNSAIQFAKAIE
KYRIFLYEEPIHPLNSDNMQKVSRSTTIPIATGERSYTRWGYRELLEKQSIAVAQPDLCL
CGGITEGKKICDYANIYDTTVQVHVCGGPVSTVAALHMETAIPNFIIHEHHTNAMKASIR
ELCTHDYQPENGYYVAPEQPGLGQELNDEVVKEYLAYVIK
Download sequence
Identical sequences A0A0L3JBW8 A0A0N1QW07 A0A100PN03 A0A1J4RDR6 A0A1S0ZMY9 A0A1X2RLN7 A0A1X2UMH7 A0A1X2Y1Q2 A0A1Z3PZM7 A0A221YMY2 A0A267SDB9 A0A271CIH7 A0A271CQ58 A0A2C6GDY9 A0A2D1XPW6 A0A2G1PER8 A0A2I6M625 A0A2I6MJG5 A0A2I6NBN4 A0A2I6P290 A0A2K2ZUL8 B5EYV8 S5HVJ6 V7IJV8 V7UGP5
439843.SeSA_A2499 454166.SeAg_B2409 gi|452123894|ref|YP_007474142.1| WP_000705581.1.100007 WP_000705581.1.100031 WP_000705581.1.10013 WP_000705581.1.100137 WP_000705581.1.100165 WP_000705581.1.1002 WP_000705581.1.100413 WP_000705581.1.100432 WP_000705581.1.100589 WP_000705581.1.10065 WP_000705581.1.100721 WP_000705581.1.10074 WP_000705581.1.100790 WP_000705581.1.100865 WP_000705581.1.100886 WP_000705581.1.100932 WP_000705581.1.100944 WP_000705581.1.101094 WP_000705581.1.101147 WP_000705581.1.101223 WP_000705581.1.101473 WP_000705581.1.101519 WP_000705581.1.101609 WP_000705581.1.101639 WP_000705581.1.10164 WP_000705581.1.101740 WP_000705581.1.101759 WP_000705581.1.101776 WP_000705581.1.101839 WP_000705581.1.101868 WP_000705581.1.102103 WP_000705581.1.10293 WP_000705581.1.10394 WP_000705581.1.10463 WP_000705581.1.10465 WP_000705581.1.10507 WP_000705581.1.10562 WP_000705581.1.10797 WP_000705581.1.11041 WP_000705581.1.11213 WP_000705581.1.113 WP_000705581.1.1135 WP_000705581.1.11369 WP_000705581.1.11405 WP_000705581.1.11444 WP_000705581.1.11544 WP_000705581.1.11621 WP_000705581.1.11681 WP_000705581.1.12007 WP_000705581.1.12047 WP_000705581.1.12059 WP_000705581.1.12144 WP_000705581.1.12159 WP_000705581.1.12160 WP_000705581.1.12396 WP_000705581.1.12472 WP_000705581.1.1250 WP_000705581.1.12650 WP_000705581.1.12877 WP_000705581.1.1299 WP_000705581.1.13101 WP_000705581.1.13429 WP_000705581.1.13528 WP_000705581.1.13750 WP_000705581.1.13764 WP_000705581.1.13799 WP_000705581.1.13819 WP_000705581.1.13827 WP_000705581.1.13829 WP_000705581.1.13857 WP_000705581.1.14296 WP_000705581.1.14369 WP_000705581.1.14495 WP_000705581.1.14519 WP_000705581.1.14528 WP_000705581.1.14706 WP_000705581.1.14917 WP_000705581.1.14927 WP_000705581.1.14964 WP_000705581.1.15046 WP_000705581.1.15054 WP_000705581.1.15059 WP_000705581.1.15479 WP_000705581.1.15616 WP_000705581.1.15644 WP_000705581.1.15795 WP_000705581.1.15835 WP_000705581.1.15881 WP_000705581.1.15922 WP_000705581.1.15978 WP_000705581.1.16000 WP_000705581.1.16158 WP_000705581.1.16166 WP_000705581.1.16201 WP_000705581.1.16508 WP_000705581.1.16656 WP_000705581.1.16736 WP_000705581.1.16804 WP_000705581.1.16817 WP_000705581.1.16826 WP_000705581.1.16846 WP_000705581.1.16855 WP_000705581.1.16910 WP_000705581.1.16942 WP_000705581.1.17031 WP_000705581.1.17188 WP_000705581.1.17270 WP_000705581.1.17439 WP_000705581.1.1749 WP_000705581.1.17504 WP_000705581.1.17560 WP_000705581.1.17901 WP_000705581.1.17949 WP_000705581.1.18022 WP_000705581.1.1807 WP_000705581.1.18103 WP_000705581.1.1814 WP_000705581.1.18277 WP_000705581.1.18365 WP_000705581.1.18426 WP_000705581.1.18445 WP_000705581.1.18485 WP_000705581.1.18489 WP_000705581.1.19038 WP_000705581.1.19055 WP_000705581.1.19174 WP_000705581.1.19291 WP_000705581.1.1939 WP_000705581.1.19405 WP_000705581.1.19469 WP_000705581.1.19683 WP_000705581.1.19723 WP_000705581.1.19823 WP_000705581.1.19863 WP_000705581.1.19967 WP_000705581.1.19970 WP_000705581.1.20023 WP_000705581.1.20081 WP_000705581.1.20091 WP_000705581.1.20349 WP_000705581.1.20573 WP_000705581.1.20631 WP_000705581.1.20795 WP_000705581.1.20810 WP_000705581.1.2091 WP_000705581.1.2101 WP_000705581.1.21075 WP_000705581.1.21086 WP_000705581.1.21165 WP_000705581.1.21181 WP_000705581.1.21260 WP_000705581.1.21286 WP_000705581.1.21309 WP_000705581.1.21326 WP_000705581.1.21399 WP_000705581.1.21423 WP_000705581.1.21443 WP_000705581.1.21453 WP_000705581.1.21473 WP_000705581.1.21750 WP_000705581.1.21886 WP_000705581.1.21910 WP_000705581.1.22069 WP_000705581.1.22169 WP_000705581.1.22205 WP_000705581.1.22315 WP_000705581.1.22388 WP_000705581.1.22453 WP_000705581.1.22604 WP_000705581.1.22623 WP_000705581.1.22855 WP_000705581.1.22966 WP_000705581.1.23010 WP_000705581.1.23053 WP_000705581.1.23080 WP_000705581.1.23175 WP_000705581.1.23201 WP_000705581.1.23246 WP_000705581.1.23258 WP_000705581.1.23274 WP_000705581.1.23311 WP_000705581.1.23343 WP_000705581.1.23409 WP_000705581.1.2342 WP_000705581.1.23485 WP_000705581.1.23500 WP_000705581.1.23529 WP_000705581.1.23587 WP_000705581.1.23629 WP_000705581.1.23675 WP_000705581.1.237 WP_000705581.1.23707 WP_000705581.1.23720 WP_000705581.1.23755 WP_000705581.1.2380 WP_000705581.1.24158 WP_000705581.1.24303 WP_000705581.1.24412 WP_000705581.1.24419 WP_000705581.1.24521 WP_000705581.1.2467 WP_000705581.1.24686 WP_000705581.1.24689 WP_000705581.1.24696 WP_000705581.1.24727 WP_000705581.1.24839 WP_000705581.1.24873 WP_000705581.1.25064 WP_000705581.1.25130 WP_000705581.1.25205 WP_000705581.1.25229 WP_000705581.1.25297 WP_000705581.1.25397 WP_000705581.1.25514 WP_000705581.1.25546 WP_000705581.1.25596 WP_000705581.1.25708 WP_000705581.1.25809 WP_000705581.1.2581 WP_000705581.1.26075 WP_000705581.1.26093 WP_000705581.1.26129 WP_000705581.1.26224 WP_000705581.1.26512 WP_000705581.1.26563 WP_000705581.1.26646 WP_000705581.1.26709 WP_000705581.1.26758 WP_000705581.1.26833 WP_000705581.1.26883 WP_000705581.1.26924 WP_000705581.1.27169 WP_000705581.1.272 WP_000705581.1.2723 WP_000705581.1.27452 WP_000705581.1.27535 WP_000705581.1.27655 WP_000705581.1.27679 WP_000705581.1.27713 WP_000705581.1.27969 WP_000705581.1.28002 WP_000705581.1.2806 WP_000705581.1.28073 WP_000705581.1.28174 WP_000705581.1.28225 WP_000705581.1.28673 WP_000705581.1.28811 WP_000705581.1.28830 WP_000705581.1.28921 WP_000705581.1.28963 WP_000705581.1.28977 WP_000705581.1.29099 WP_000705581.1.29174 WP_000705581.1.29190 WP_000705581.1.29255 WP_000705581.1.29265 WP_000705581.1.29530 WP_000705581.1.29593 WP_000705581.1.29682 WP_000705581.1.29732 WP_000705581.1.29768 WP_000705581.1.29775 WP_000705581.1.2984 WP_000705581.1.29845 WP_000705581.1.29898 WP_000705581.1.30018 WP_000705581.1.30086 WP_000705581.1.30093 WP_000705581.1.30170 WP_000705581.1.30213 WP_000705581.1.30225 WP_000705581.1.30331 WP_000705581.1.30386 WP_000705581.1.30425 WP_000705581.1.3066 WP_000705581.1.30696 WP_000705581.1.3076 WP_000705581.1.30802 WP_000705581.1.30823 WP_000705581.1.3089 WP_000705581.1.3095 WP_000705581.1.31011 WP_000705581.1.31111 WP_000705581.1.31155 WP_000705581.1.31156 WP_000705581.1.31171 WP_000705581.1.31198 WP_000705581.1.31262 WP_000705581.1.31782 WP_000705581.1.3185 WP_000705581.1.31952 WP_000705581.1.32038 WP_000705581.1.32054 WP_000705581.1.32056 WP_000705581.1.32170 WP_000705581.1.32277 WP_000705581.1.32357 WP_000705581.1.32368 WP_000705581.1.32459 WP_000705581.1.32545 WP_000705581.1.32643 WP_000705581.1.32750 WP_000705581.1.32900 WP_000705581.1.32930 WP_000705581.1.33010 WP_000705581.1.3304 WP_000705581.1.3310 WP_000705581.1.33114 WP_000705581.1.33144 WP_000705581.1.33392 WP_000705581.1.33693 WP_000705581.1.33870 WP_000705581.1.3395 WP_000705581.1.34022 WP_000705581.1.34084 WP_000705581.1.34179 WP_000705581.1.34184 WP_000705581.1.34330 WP_000705581.1.34647 WP_000705581.1.34659 WP_000705581.1.34703 WP_000705581.1.34704 WP_000705581.1.34707 WP_000705581.1.34801 WP_000705581.1.34817 WP_000705581.1.34881 WP_000705581.1.35125 WP_000705581.1.35294 WP_000705581.1.35494 WP_000705581.1.3556 WP_000705581.1.35809 WP_000705581.1.35835 WP_000705581.1.35868 WP_000705581.1.35993 WP_000705581.1.3610 WP_000705581.1.36172 WP_000705581.1.36229 WP_000705581.1.36232 WP_000705581.1.36236 WP_000705581.1.36512 WP_000705581.1.36592 WP_000705581.1.36652 WP_000705581.1.36792 WP_000705581.1.36839 WP_000705581.1.36885 WP_000705581.1.37021 WP_000705581.1.37028 WP_000705581.1.37100 WP_000705581.1.37147 WP_000705581.1.37158 WP_000705581.1.3728 WP_000705581.1.37363 WP_000705581.1.3751 WP_000705581.1.37808 WP_000705581.1.37848 WP_000705581.1.37965 WP_000705581.1.38026 WP_000705581.1.38055 WP_000705581.1.38113 WP_000705581.1.3828 WP_000705581.1.38322 WP_000705581.1.38341 WP_000705581.1.38349 WP_000705581.1.38512 WP_000705581.1.38609 WP_000705581.1.38622 WP_000705581.1.38830 WP_000705581.1.38857 WP_000705581.1.38898 WP_000705581.1.38942 WP_000705581.1.38995 WP_000705581.1.39059 WP_000705581.1.39075 WP_000705581.1.39082 WP_000705581.1.39128 WP_000705581.1.39140 WP_000705581.1.39146 WP_000705581.1.39183 WP_000705581.1.39311 WP_000705581.1.39466 WP_000705581.1.39503 WP_000705581.1.39722 WP_000705581.1.39808 WP_000705581.1.40008 WP_000705581.1.40025 WP_000705581.1.40155 WP_000705581.1.40170 WP_000705581.1.40171 WP_000705581.1.40224 WP_000705581.1.40254 WP_000705581.1.40259 WP_000705581.1.40374 WP_000705581.1.40492 WP_000705581.1.40605 WP_000705581.1.40693 WP_000705581.1.40722 WP_000705581.1.4088 WP_000705581.1.40910 WP_000705581.1.40935 WP_000705581.1.4109 WP_000705581.1.41225 WP_000705581.1.41265 WP_000705581.1.41308 WP_000705581.1.41375 WP_000705581.1.41468 WP_000705581.1.41593 WP_000705581.1.41628 WP_000705581.1.41735 WP_000705581.1.4184 WP_000705581.1.41897 WP_000705581.1.41904 WP_000705581.1.41938 WP_000705581.1.42109 WP_000705581.1.42244 WP_000705581.1.42356 WP_000705581.1.42404 WP_000705581.1.42433 WP_000705581.1.42453 WP_000705581.1.42489 WP_000705581.1.4257 WP_000705581.1.42655 WP_000705581.1.42794 WP_000705581.1.42978 WP_000705581.1.43126 WP_000705581.1.43149 WP_000705581.1.43520 WP_000705581.1.43535 WP_000705581.1.43606 WP_000705581.1.43654 WP_000705581.1.43676 WP_000705581.1.4373 WP_000705581.1.43763 WP_000705581.1.43782 WP_000705581.1.43839 WP_000705581.1.4404 WP_000705581.1.44113 WP_000705581.1.44191 WP_000705581.1.4422 WP_000705581.1.44339 WP_000705581.1.44359 WP_000705581.1.44380 WP_000705581.1.44453 WP_000705581.1.44549 WP_000705581.1.44636 WP_000705581.1.44791 WP_000705581.1.44795 WP_000705581.1.44996 WP_000705581.1.44998 WP_000705581.1.45038 WP_000705581.1.45045 WP_000705581.1.45123 WP_000705581.1.45134 WP_000705581.1.45138 WP_000705581.1.45154 WP_000705581.1.45229 WP_000705581.1.45268 WP_000705581.1.45351 WP_000705581.1.45402 WP_000705581.1.45462 WP_000705581.1.45544 WP_000705581.1.45984 WP_000705581.1.46124 WP_000705581.1.46299 WP_000705581.1.46345 WP_000705581.1.46358 WP_000705581.1.46499 WP_000705581.1.46637 WP_000705581.1.46689 WP_000705581.1.46803 WP_000705581.1.46804 WP_000705581.1.47014 WP_000705581.1.47058 WP_000705581.1.47389 WP_000705581.1.47442 WP_000705581.1.47460 WP_000705581.1.47482 WP_000705581.1.47492 WP_000705581.1.47587 WP_000705581.1.47614 WP_000705581.1.4769 WP_000705581.1.47767 WP_000705581.1.48132 WP_000705581.1.48215 WP_000705581.1.48244 WP_000705581.1.48262 WP_000705581.1.48399 WP_000705581.1.48647 WP_000705581.1.48651 WP_000705581.1.48751 WP_000705581.1.48774 WP_000705581.1.48896 WP_000705581.1.48918 WP_000705581.1.48931 WP_000705581.1.49005 WP_000705581.1.49090 WP_000705581.1.49214 WP_000705581.1.49309 WP_000705581.1.49358 WP_000705581.1.49375 WP_000705581.1.49550 WP_000705581.1.49574 WP_000705581.1.49590 WP_000705581.1.49595 WP_000705581.1.49630 WP_000705581.1.49780 WP_000705581.1.49848 WP_000705581.1.50 WP_000705581.1.50198 WP_000705581.1.50238 WP_000705581.1.50413 WP_000705581.1.50517 WP_000705581.1.50565 WP_000705581.1.5058 WP_000705581.1.50769 WP_000705581.1.50782 WP_000705581.1.50811 WP_000705581.1.50893 WP_000705581.1.50954 WP_000705581.1.51025 WP_000705581.1.51036 WP_000705581.1.5114 WP_000705581.1.51178 WP_000705581.1.5125 WP_000705581.1.51338 WP_000705581.1.5138 WP_000705581.1.51394 WP_000705581.1.51506 WP_000705581.1.51615 WP_000705581.1.51704 WP_000705581.1.51900 WP_000705581.1.51910 WP_000705581.1.52255 WP_000705581.1.52356 WP_000705581.1.52446 WP_000705581.1.52527 WP_000705581.1.52608 WP_000705581.1.52637 WP_000705581.1.5273 WP_000705581.1.52738 WP_000705581.1.52924 WP_000705581.1.5301 WP_000705581.1.53100 WP_000705581.1.53158 WP_000705581.1.53203 WP_000705581.1.53274 WP_000705581.1.53286 WP_000705581.1.53315 WP_000705581.1.53316 WP_000705581.1.53790 WP_000705581.1.53814 WP_000705581.1.5392 WP_000705581.1.54085 WP_000705581.1.5415 WP_000705581.1.54159 WP_000705581.1.54324 WP_000705581.1.54500 WP_000705581.1.54558 WP_000705581.1.5459 WP_000705581.1.54822 WP_000705581.1.55166 WP_000705581.1.55178 WP_000705581.1.55224 WP_000705581.1.55361 WP_000705581.1.5552 WP_000705581.1.55528 WP_000705581.1.55672 WP_000705581.1.55803 WP_000705581.1.55995 WP_000705581.1.56004 WP_000705581.1.56069 WP_000705581.1.56082 WP_000705581.1.56130 WP_000705581.1.56152 WP_000705581.1.56222 WP_000705581.1.56354 WP_000705581.1.56385 WP_000705581.1.56396 WP_000705581.1.56615 WP_000705581.1.56642 WP_000705581.1.56824 WP_000705581.1.57076 WP_000705581.1.57233 WP_000705581.1.57344 WP_000705581.1.57399 WP_000705581.1.57494 WP_000705581.1.57495 WP_000705581.1.57510 WP_000705581.1.57521 WP_000705581.1.57709 WP_000705581.1.57710 WP_000705581.1.57781 WP_000705581.1.57857 WP_000705581.1.58131 WP_000705581.1.58153 WP_000705581.1.58239 WP_000705581.1.58251 WP_000705581.1.58334 WP_000705581.1.58357 WP_000705581.1.58416 WP_000705581.1.5846 WP_000705581.1.58698 WP_000705581.1.58744 WP_000705581.1.5878 WP_000705581.1.58831 WP_000705581.1.59012 WP_000705581.1.59084 WP_000705581.1.59148 WP_000705581.1.59236 WP_000705581.1.5929 WP_000705581.1.59412 WP_000705581.1.59439 WP_000705581.1.59521 WP_000705581.1.59562 WP_000705581.1.59604 WP_000705581.1.59636 WP_000705581.1.59755 WP_000705581.1.59979 WP_000705581.1.60330 WP_000705581.1.60370 WP_000705581.1.60469 WP_000705581.1.60503 WP_000705581.1.6052 WP_000705581.1.60622 WP_000705581.1.60760 WP_000705581.1.6086 WP_000705581.1.60863 WP_000705581.1.6090 WP_000705581.1.60926 WP_000705581.1.60976 WP_000705581.1.60988 WP_000705581.1.60990 WP_000705581.1.61045 WP_000705581.1.61146 WP_000705581.1.61519 WP_000705581.1.61582 WP_000705581.1.61667 WP_000705581.1.61732 WP_000705581.1.61737 WP_000705581.1.61743 WP_000705581.1.61924 WP_000705581.1.61968 WP_000705581.1.62108 WP_000705581.1.62120 WP_000705581.1.62122 WP_000705581.1.62144 WP_000705581.1.62310 WP_000705581.1.62344 WP_000705581.1.62361 WP_000705581.1.62486 WP_000705581.1.62488 WP_000705581.1.62504 WP_000705581.1.62522 WP_000705581.1.62648 WP_000705581.1.62693 WP_000705581.1.62725 WP_000705581.1.62828 WP_000705581.1.62976 WP_000705581.1.63129 WP_000705581.1.63455 WP_000705581.1.63499 WP_000705581.1.6357 WP_000705581.1.63633 WP_000705581.1.6367 WP_000705581.1.63690 WP_000705581.1.63731 WP_000705581.1.63860 WP_000705581.1.63864 WP_000705581.1.63866 WP_000705581.1.63912 WP_000705581.1.63958 WP_000705581.1.63977 WP_000705581.1.6399 WP_000705581.1.64072 WP_000705581.1.64389 WP_000705581.1.6451 WP_000705581.1.64798 WP_000705581.1.65022 WP_000705581.1.65295 WP_000705581.1.65348 WP_000705581.1.65363 WP_000705581.1.65394 WP_000705581.1.65437 WP_000705581.1.65508 WP_000705581.1.65558 WP_000705581.1.6560 WP_000705581.1.6561 WP_000705581.1.65687 WP_000705581.1.65849 WP_000705581.1.66082 WP_000705581.1.66368 WP_000705581.1.66462 WP_000705581.1.6647 WP_000705581.1.66779 WP_000705581.1.66800 WP_000705581.1.66825 WP_000705581.1.67175 WP_000705581.1.67405 WP_000705581.1.67424 WP_000705581.1.67617 WP_000705581.1.67633 WP_000705581.1.67637 WP_000705581.1.67707 WP_000705581.1.67772 WP_000705581.1.67776 WP_000705581.1.67814 WP_000705581.1.6785 WP_000705581.1.67969 WP_000705581.1.67988 WP_000705581.1.68075 WP_000705581.1.68147 WP_000705581.1.68167 WP_000705581.1.68478 WP_000705581.1.685 WP_000705581.1.6857 WP_000705581.1.6858 WP_000705581.1.68629 WP_000705581.1.68658 WP_000705581.1.6879 WP_000705581.1.68816 WP_000705581.1.68966 WP_000705581.1.68999 WP_000705581.1.69011 WP_000705581.1.69029 WP_000705581.1.69139 WP_000705581.1.69320 WP_000705581.1.69385 WP_000705581.1.69554 WP_000705581.1.69696 WP_000705581.1.69710 WP_000705581.1.69760 WP_000705581.1.69787 WP_000705581.1.69790 WP_000705581.1.69977 WP_000705581.1.70003 WP_000705581.1.70028 WP_000705581.1.70047 WP_000705581.1.70087 WP_000705581.1.7010 WP_000705581.1.70169 WP_000705581.1.70183 WP_000705581.1.70281 WP_000705581.1.70290 WP_000705581.1.70327 WP_000705581.1.70355 WP_000705581.1.7044 WP_000705581.1.70491 WP_000705581.1.70644 WP_000705581.1.70733 WP_000705581.1.70761 WP_000705581.1.70797 WP_000705581.1.70899 WP_000705581.1.7093 WP_000705581.1.70969 WP_000705581.1.70986 WP_000705581.1.71088 WP_000705581.1.71268 WP_000705581.1.71299 WP_000705581.1.7134 WP_000705581.1.714 WP_000705581.1.7142 WP_000705581.1.71450 WP_000705581.1.71452 WP_000705581.1.71583 WP_000705581.1.71667 WP_000705581.1.71746 WP_000705581.1.71923 WP_000705581.1.71941 WP_000705581.1.72119 WP_000705581.1.72234 WP_000705581.1.72243 WP_000705581.1.72283 WP_000705581.1.72307 WP_000705581.1.72412 WP_000705581.1.7243 WP_000705581.1.72438 WP_000705581.1.72629 WP_000705581.1.72671 WP_000705581.1.72793 WP_000705581.1.72872 WP_000705581.1.72897 WP_000705581.1.72944 WP_000705581.1.7316 WP_000705581.1.73328 WP_000705581.1.73362 WP_000705581.1.73379 WP_000705581.1.7341 WP_000705581.1.73701 WP_000705581.1.7374 WP_000705581.1.73804 WP_000705581.1.73945 WP_000705581.1.74028 WP_000705581.1.74040 WP_000705581.1.7405 WP_000705581.1.74089 WP_000705581.1.74414 WP_000705581.1.74428 WP_000705581.1.74454 WP_000705581.1.74469 WP_000705581.1.74481 WP_000705581.1.74570 WP_000705581.1.7458 WP_000705581.1.74632 WP_000705581.1.74757 WP_000705581.1.74806 WP_000705581.1.74876 WP_000705581.1.74946 WP_000705581.1.75114 WP_000705581.1.75134 WP_000705581.1.75168 WP_000705581.1.75301 WP_000705581.1.7531 WP_000705581.1.75585 WP_000705581.1.75626 WP_000705581.1.76 WP_000705581.1.76102 WP_000705581.1.76156 WP_000705581.1.76164 WP_000705581.1.76170 WP_000705581.1.76197 WP_000705581.1.7634 WP_000705581.1.76346 WP_000705581.1.7655 WP_000705581.1.76611 WP_000705581.1.76799 WP_000705581.1.7684 WP_000705581.1.76866 WP_000705581.1.77017 WP_000705581.1.77241 WP_000705581.1.77313 WP_000705581.1.77431 WP_000705581.1.77440 WP_000705581.1.77555 WP_000705581.1.77575 WP_000705581.1.77596 WP_000705581.1.77629 WP_000705581.1.77646 WP_000705581.1.77871 WP_000705581.1.77971 WP_000705581.1.78 WP_000705581.1.78026 WP_000705581.1.7814 WP_000705581.1.78168 WP_000705581.1.78180 WP_000705581.1.78259 WP_000705581.1.78502 WP_000705581.1.78715 WP_000705581.1.78771 WP_000705581.1.78789 WP_000705581.1.78881 WP_000705581.1.78913 WP_000705581.1.7893 WP_000705581.1.79011 WP_000705581.1.79081 WP_000705581.1.79140 WP_000705581.1.794 WP_000705581.1.79466 WP_000705581.1.7956 WP_000705581.1.79635 WP_000705581.1.7972 WP_000705581.1.79738 WP_000705581.1.79892 WP_000705581.1.79929 WP_000705581.1.79934 WP_000705581.1.7994 WP_000705581.1.79945 WP_000705581.1.79974 WP_000705581.1.79996 WP_000705581.1.80229 WP_000705581.1.8024 WP_000705581.1.80293 WP_000705581.1.80307 WP_000705581.1.80333 WP_000705581.1.80441 WP_000705581.1.80473 WP_000705581.1.80480 WP_000705581.1.80496 WP_000705581.1.80638 WP_000705581.1.80707 WP_000705581.1.80723 WP_000705581.1.80757 WP_000705581.1.80803 WP_000705581.1.80819 WP_000705581.1.80827 WP_000705581.1.80927 WP_000705581.1.81062 WP_000705581.1.81118 WP_000705581.1.81231 WP_000705581.1.8127 WP_000705581.1.81404 WP_000705581.1.81409 WP_000705581.1.81548 WP_000705581.1.8168 WP_000705581.1.81727 WP_000705581.1.81736 WP_000705581.1.81743 WP_000705581.1.81746 WP_000705581.1.81941 WP_000705581.1.81965 WP_000705581.1.82141 WP_000705581.1.82144 WP_000705581.1.82258 WP_000705581.1.82347 WP_000705581.1.8236 WP_000705581.1.82369 WP_000705581.1.82562 WP_000705581.1.82636 WP_000705581.1.82843 WP_000705581.1.82886 WP_000705581.1.82964 WP_000705581.1.83128 WP_000705581.1.83139 WP_000705581.1.83221 WP_000705581.1.83252 WP_000705581.1.83258 WP_000705581.1.83301 WP_000705581.1.83510 WP_000705581.1.83572 WP_000705581.1.84031 WP_000705581.1.84106 WP_000705581.1.84115 WP_000705581.1.84179 WP_000705581.1.84198 WP_000705581.1.84209 WP_000705581.1.84325 WP_000705581.1.84373 WP_000705581.1.84403 WP_000705581.1.84459 WP_000705581.1.84523 WP_000705581.1.84551 WP_000705581.1.84644 WP_000705581.1.84721 WP_000705581.1.84745 WP_000705581.1.85014 WP_000705581.1.85094 WP_000705581.1.85147 WP_000705581.1.85217 WP_000705581.1.8537 WP_000705581.1.85408 WP_000705581.1.85433 WP_000705581.1.85654 WP_000705581.1.85780 WP_000705581.1.85784 WP_000705581.1.85797 WP_000705581.1.85854 WP_000705581.1.85943 WP_000705581.1.86017 WP_000705581.1.86092 WP_000705581.1.86126 WP_000705581.1.86206 WP_000705581.1.86224 WP_000705581.1.86284 WP_000705581.1.86442 WP_000705581.1.86593 WP_000705581.1.86634 WP_000705581.1.86656 WP_000705581.1.86658 WP_000705581.1.86676 WP_000705581.1.86699 WP_000705581.1.86744 WP_000705581.1.86902 WP_000705581.1.8691 WP_000705581.1.87148 WP_000705581.1.87282 WP_000705581.1.87365 WP_000705581.1.87584 WP_000705581.1.87626 WP_000705581.1.8767 WP_000705581.1.87687 WP_000705581.1.87813 WP_000705581.1.88214 WP_000705581.1.88244 WP_000705581.1.8849 WP_000705581.1.88609 WP_000705581.1.88620 WP_000705581.1.88675 WP_000705581.1.88683 WP_000705581.1.88762 WP_000705581.1.88776 WP_000705581.1.88942 WP_000705581.1.88970 WP_000705581.1.89174 WP_000705581.1.89311 WP_000705581.1.89354 WP_000705581.1.89355 WP_000705581.1.89462 WP_000705581.1.89647 WP_000705581.1.89746 WP_000705581.1.89777 WP_000705581.1.89789 WP_000705581.1.89870 WP_000705581.1.89914 WP_000705581.1.90220 WP_000705581.1.90311 WP_000705581.1.90521 WP_000705581.1.90566 WP_000705581.1.90620 WP_000705581.1.90792 WP_000705581.1.90814 WP_000705581.1.90876 WP_000705581.1.90878 WP_000705581.1.9089 WP_000705581.1.9093 WP_000705581.1.90991 WP_000705581.1.91049 WP_000705581.1.91156 WP_000705581.1.91189 WP_000705581.1.91334 WP_000705581.1.91381 WP_000705581.1.91405 WP_000705581.1.91493 WP_000705581.1.91702 WP_000705581.1.91736 WP_000705581.1.91806 WP_000705581.1.91864 WP_000705581.1.91880 WP_000705581.1.91914 WP_000705581.1.92039 WP_000705581.1.92099 WP_000705581.1.92122 WP_000705581.1.92375 WP_000705581.1.92394 WP_000705581.1.92408 WP_000705581.1.9253 WP_000705581.1.92562 WP_000705581.1.92659 WP_000705581.1.92827 WP_000705581.1.92832 WP_000705581.1.92836 WP_000705581.1.92843 WP_000705581.1.92939 WP_000705581.1.92947 WP_000705581.1.92988 WP_000705581.1.93213 WP_000705581.1.93322 WP_000705581.1.93604 WP_000705581.1.93648 WP_000705581.1.93767 WP_000705581.1.93837 WP_000705581.1.93956 WP_000705581.1.94070 WP_000705581.1.94167 WP_000705581.1.94383 WP_000705581.1.94557 WP_000705581.1.94588 WP_000705581.1.94622 WP_000705581.1.9463 WP_000705581.1.94717 WP_000705581.1.94722 WP_000705581.1.9481 WP_000705581.1.94849 WP_000705581.1.94862 WP_000705581.1.94986 WP_000705581.1.94987 WP_000705581.1.95094 WP_000705581.1.95623 WP_000705581.1.95641 WP_000705581.1.95703 WP_000705581.1.95729 WP_000705581.1.95805 WP_000705581.1.95901 WP_000705581.1.95940 WP_000705581.1.96042 WP_000705581.1.96172 WP_000705581.1.96190 WP_000705581.1.96260 WP_000705581.1.96404 WP_000705581.1.96590 WP_000705581.1.96640 WP_000705581.1.96642 WP_000705581.1.96662 WP_000705581.1.96721 WP_000705581.1.96761 WP_000705581.1.9686 WP_000705581.1.96917 WP_000705581.1.97005 WP_000705581.1.97337 WP_000705581.1.97368 WP_000705581.1.97496 WP_000705581.1.97534 WP_000705581.1.97628 WP_000705581.1.97640 WP_000705581.1.97693 WP_000705581.1.97726 WP_000705581.1.97768 WP_000705581.1.97772 WP_000705581.1.98124 WP_000705581.1.98201 WP_000705581.1.98236 WP_000705581.1.98392 WP_000705581.1.98403 WP_000705581.1.98438 WP_000705581.1.98608 WP_000705581.1.98627 WP_000705581.1.9863 WP_000705581.1.98931 WP_000705581.1.99071 WP_000705581.1.99083 WP_000705581.1.99107 WP_000705581.1.9919 WP_000705581.1.99219 WP_000705581.1.99255 WP_000705581.1.99278 WP_000705581.1.99327 WP_000705581.1.99370 WP_000705581.1.99469 WP_000705581.1.9954 WP_000705581.1.99561 WP_000705581.1.99747 gi|525858276|ref|YP_008261550.1| gi|563653732|ref|YP_008861807.1| gi|194735769|ref|YP_002115345.1| gi|197251035|ref|YP_002147229.1| ABAK02000001|CDS_1765948-1764746 ABEH02000005|CDS_291345-290143 ABEI01000001|CDS_289851-288649 ABEJ01000010|CDS_9508-8306 CP001127|CDS_2383737-2382535 CP001138|CDS_2329441-2328239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]