SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 439851.SeD_A0549 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  439851.SeD_A0549
Domain Number 1 Region: 107-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000379
Family NfeD domain-like 0.0063
Further Details:      
 
Weak hits

Sequence:  439851.SeD_A0549
Domain Number - Region: 31-81
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00353
Family LacY-like proton/sugar symporter 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 439851.SeD_A0549
Sequence length 150
Comment (Salmonella enterica serovar Dublin CT 02021853)
Sequence
MIAMILVHPHIFWLSLGGLLLAAEMLSGNGYLLWSGVAAVITGLTVWLLPLGWEWQGVLF
SALTLLAAWLWWRWLARRVREQKPTDSRLNQRGQQLVGRRFMLDAALVNGRGHMRVGDSS
WPVCADEDLRAGTHVEVIAVEGITLRIRAV
Download sequence
Identical sequences WP_000561183.1.87936 WP_000561183.1.94983 gi|198243760|ref|YP_002214456.1| CP001144|CDS_564858-564406 439851.SeD_A0549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]