SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 439851.SeD_A1834 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  439851.SeD_A1834
Domain Number 1 Region: 98-388
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.57e-79
Family D-glucarate dehydratase-like 0.00018
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 9.87e-34
Family Enolase N-terminal domain-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 439851.SeD_A1834
Sequence length 404
Comment (Salmonella enterica serovar Dublin CT 02021853)
Sequence
MKIVGAEVFVTCPGRNFVTLKITTEDGITGLGDATLNGRELPVASYLTDHLCPQLIGRDA
RRIEDIWQFFYKGAYWRRGPVTMSAISAVDMALWDIKAKAANMPLYQLLGGASREGVMVY
CHTTGHTIDDVLEDYARHKEQGFKAIRVQCGVPGMKTTYGMAKGKGLAYEPATKGQWPEE
QLWSTEKYLDFTPKLFDAVRNTFGFNEHLLHDMHHRLTPIEAARFGKSIEDYRLFWMEDP
TPAENQACFRLIRQHTVTPIAVGEVFNSIWDCKQLIEEQLIDYIRTTLTHAGGITGMRRI
ADFASLYQVRTGSHGPSDLSPVCMAAALHFDLWVPNFGVQEFMGYSEQMLEVFPHNWTFE
GGYMHPGDKPGLGIEFDEKLAAKYPYDPAYLPVARLEDGTLWNW
Download sequence
Identical sequences A0A0T9Y5S8 A0A1X2V4G1 A0A232SZV0 A0A2D3GED7 C0Q4W2 G5L9D1 G5SC19 M7RIE7 S5HL06 V7IKF9 V7UXI1
gi|452120321|ref|YP_007470569.1| WP_000706269.1.100017 WP_000706269.1.100115 WP_000706269.1.100589 WP_000706269.1.100707 WP_000706269.1.100773 WP_000706269.1.100870 WP_000706269.1.101042 WP_000706269.1.101091 WP_000706269.1.101094 WP_000706269.1.101123 WP_000706269.1.101199 WP_000706269.1.101473 WP_000706269.1.101639 WP_000706269.1.101740 WP_000706269.1.101741 WP_000706269.1.101841 WP_000706269.1.10191 WP_000706269.1.101927 WP_000706269.1.102103 WP_000706269.1.10237 WP_000706269.1.10310 WP_000706269.1.10521 WP_000706269.1.10568 WP_000706269.1.11213 WP_000706269.1.11254 WP_000706269.1.11868 WP_000706269.1.11875 WP_000706269.1.12244 WP_000706269.1.12280 WP_000706269.1.1239 WP_000706269.1.12396 WP_000706269.1.12397 WP_000706269.1.12456 WP_000706269.1.12584 WP_000706269.1.13677 WP_000706269.1.14286 WP_000706269.1.1440 WP_000706269.1.14516 WP_000706269.1.14519 WP_000706269.1.14688 WP_000706269.1.14789 WP_000706269.1.15079 WP_000706269.1.15102 WP_000706269.1.15214 WP_000706269.1.15353 WP_000706269.1.15637 WP_000706269.1.158 WP_000706269.1.15909 WP_000706269.1.16032 WP_000706269.1.1611 WP_000706269.1.16172 WP_000706269.1.16244 WP_000706269.1.16273 WP_000706269.1.16565 WP_000706269.1.16736 WP_000706269.1.16817 WP_000706269.1.16819 WP_000706269.1.16855 WP_000706269.1.1689 WP_000706269.1.17098 WP_000706269.1.17390 WP_000706269.1.17504 WP_000706269.1.17693 WP_000706269.1.17755 WP_000706269.1.17865 WP_000706269.1.17919 WP_000706269.1.18103 WP_000706269.1.18177 WP_000706269.1.18485 WP_000706269.1.18972 WP_000706269.1.20034 WP_000706269.1.20119 WP_000706269.1.20349 WP_000706269.1.2036 WP_000706269.1.20503 WP_000706269.1.20700 WP_000706269.1.20721 WP_000706269.1.20767 WP_000706269.1.20839 WP_000706269.1.2091 WP_000706269.1.2130 WP_000706269.1.21453 WP_000706269.1.21616 WP_000706269.1.21825 WP_000706269.1.2224 WP_000706269.1.22388 WP_000706269.1.22582 WP_000706269.1.22590 WP_000706269.1.23201 WP_000706269.1.23466 WP_000706269.1.23513 WP_000706269.1.23529 WP_000706269.1.23643 WP_000706269.1.23685 WP_000706269.1.23707 WP_000706269.1.23819 WP_000706269.1.24325 WP_000706269.1.24803 WP_000706269.1.25036 WP_000706269.1.25421 WP_000706269.1.25498 WP_000706269.1.2554 WP_000706269.1.2568 WP_000706269.1.25703 WP_000706269.1.25709 WP_000706269.1.25825 WP_000706269.1.25932 WP_000706269.1.26030 WP_000706269.1.2634 WP_000706269.1.26512 WP_000706269.1.26532 WP_000706269.1.26563 WP_000706269.1.26576 WP_000706269.1.26587 WP_000706269.1.2660 WP_000706269.1.26758 WP_000706269.1.26787 WP_000706269.1.26856 WP_000706269.1.26980 WP_000706269.1.27122 WP_000706269.1.27255 WP_000706269.1.27279 WP_000706269.1.27522 WP_000706269.1.27523 WP_000706269.1.27556 WP_000706269.1.27755 WP_000706269.1.28225 WP_000706269.1.28267 WP_000706269.1.28301 WP_000706269.1.287 WP_000706269.1.28902 WP_000706269.1.29274 WP_000706269.1.29775 WP_000706269.1.29898 WP_000706269.1.29924 WP_000706269.1.30093 WP_000706269.1.3017 WP_000706269.1.30195 WP_000706269.1.30238 WP_000706269.1.30246 WP_000706269.1.30356 WP_000706269.1.30573 WP_000706269.1.30602 WP_000706269.1.30619 WP_000706269.1.3067 WP_000706269.1.3080 WP_000706269.1.30803 WP_000706269.1.31107 WP_000706269.1.31156 WP_000706269.1.31214 WP_000706269.1.3124 WP_000706269.1.31251 WP_000706269.1.3170 WP_000706269.1.31725 WP_000706269.1.31762 WP_000706269.1.31983 WP_000706269.1.32277 WP_000706269.1.32629 WP_000706269.1.32747 WP_000706269.1.33010 WP_000706269.1.33078 WP_000706269.1.3310 WP_000706269.1.33499 WP_000706269.1.33609 WP_000706269.1.33659 WP_000706269.1.33865 WP_000706269.1.3395 WP_000706269.1.34107 WP_000706269.1.34184 WP_000706269.1.34259 WP_000706269.1.3445 WP_000706269.1.34659 WP_000706269.1.34667 WP_000706269.1.34684 WP_000706269.1.34817 WP_000706269.1.35332 WP_000706269.1.35619 WP_000706269.1.35648 WP_000706269.1.3566 WP_000706269.1.3572 WP_000706269.1.35868 WP_000706269.1.36652 WP_000706269.1.37013 WP_000706269.1.3726 WP_000706269.1.3734 WP_000706269.1.37351 WP_000706269.1.3756 WP_000706269.1.37610 WP_000706269.1.37666 WP_000706269.1.38001 WP_000706269.1.38609 WP_000706269.1.39113 WP_000706269.1.39385 WP_000706269.1.39414 WP_000706269.1.39471 WP_000706269.1.39576 WP_000706269.1.39614 WP_000706269.1.40158 WP_000706269.1.40170 WP_000706269.1.40284 WP_000706269.1.40648 WP_000706269.1.40788 WP_000706269.1.40979 WP_000706269.1.41310 WP_000706269.1.4141 WP_000706269.1.41434 WP_000706269.1.41440 WP_000706269.1.41862 WP_000706269.1.41931 WP_000706269.1.41938 WP_000706269.1.42248 WP_000706269.1.4239 WP_000706269.1.42489 WP_000706269.1.42605 WP_000706269.1.42707 WP_000706269.1.42767 WP_000706269.1.4289 WP_000706269.1.42923 WP_000706269.1.42957 WP_000706269.1.42978 WP_000706269.1.43272 WP_000706269.1.43438 WP_000706269.1.43508 WP_000706269.1.43528 WP_000706269.1.43535 WP_000706269.1.43710 WP_000706269.1.43782 WP_000706269.1.43864 WP_000706269.1.44113 WP_000706269.1.44250 WP_000706269.1.44397 WP_000706269.1.4440 WP_000706269.1.44438 WP_000706269.1.44443 WP_000706269.1.44607 WP_000706269.1.44633 WP_000706269.1.44678 WP_000706269.1.44833 WP_000706269.1.44950 WP_000706269.1.45038 WP_000706269.1.45045 WP_000706269.1.45462 WP_000706269.1.45468 WP_000706269.1.4592 WP_000706269.1.46028 WP_000706269.1.46124 WP_000706269.1.46232 WP_000706269.1.46286 WP_000706269.1.46299 WP_000706269.1.46322 WP_000706269.1.46406 WP_000706269.1.46444 WP_000706269.1.46574 WP_000706269.1.46620 WP_000706269.1.46666 WP_000706269.1.4671 WP_000706269.1.46732 WP_000706269.1.46749 WP_000706269.1.47058 WP_000706269.1.47067 WP_000706269.1.47492 WP_000706269.1.47649 WP_000706269.1.4775 WP_000706269.1.47814 WP_000706269.1.47849 WP_000706269.1.48209 WP_000706269.1.48268 WP_000706269.1.48493 WP_000706269.1.48570 WP_000706269.1.48651 WP_000706269.1.48886 WP_000706269.1.48985 WP_000706269.1.49175 WP_000706269.1.49276 WP_000706269.1.49304 WP_000706269.1.49358 WP_000706269.1.49443 WP_000706269.1.49472 WP_000706269.1.49602 WP_000706269.1.49848 WP_000706269.1.50003 WP_000706269.1.50198 WP_000706269.1.50238 WP_000706269.1.50374 WP_000706269.1.50413 WP_000706269.1.50469 WP_000706269.1.50478 WP_000706269.1.50563 WP_000706269.1.50565 WP_000706269.1.5058 WP_000706269.1.50782 WP_000706269.1.50893 WP_000706269.1.50905 WP_000706269.1.51025 WP_000706269.1.51285 WP_000706269.1.51308 WP_000706269.1.51394 WP_000706269.1.51419 WP_000706269.1.51514 WP_000706269.1.51613 WP_000706269.1.51700 WP_000706269.1.52047 WP_000706269.1.52156 WP_000706269.1.52161 WP_000706269.1.52438 WP_000706269.1.52528 WP_000706269.1.53286 WP_000706269.1.5333 WP_000706269.1.53534 WP_000706269.1.53935 WP_000706269.1.54136 WP_000706269.1.54469 WP_000706269.1.54569 WP_000706269.1.5459 WP_000706269.1.54694 WP_000706269.1.54822 WP_000706269.1.55223 WP_000706269.1.5523 WP_000706269.1.55361 WP_000706269.1.55545 WP_000706269.1.5555 WP_000706269.1.55623 WP_000706269.1.55706 WP_000706269.1.55853 WP_000706269.1.56097 WP_000706269.1.56152 WP_000706269.1.56222 WP_000706269.1.56303 WP_000706269.1.56370 WP_000706269.1.56468 WP_000706269.1.56615 WP_000706269.1.56651 WP_000706269.1.56853 WP_000706269.1.56893 WP_000706269.1.56905 WP_000706269.1.57125 WP_000706269.1.57233 WP_000706269.1.57307 WP_000706269.1.57399 WP_000706269.1.5753 WP_000706269.1.58040 WP_000706269.1.58144 WP_000706269.1.58442 WP_000706269.1.58698 WP_000706269.1.58749 WP_000706269.1.5878 WP_000706269.1.58836 WP_000706269.1.59084 WP_000706269.1.59136 WP_000706269.1.59294 WP_000706269.1.59335 WP_000706269.1.59336 WP_000706269.1.59381 WP_000706269.1.59521 WP_000706269.1.59641 WP_000706269.1.59710 WP_000706269.1.59830 WP_000706269.1.60015 WP_000706269.1.60052 WP_000706269.1.60226 WP_000706269.1.60330 WP_000706269.1.60370 WP_000706269.1.60794 WP_000706269.1.60855 WP_000706269.1.60919 WP_000706269.1.60990 WP_000706269.1.61045 WP_000706269.1.61114 WP_000706269.1.61184 WP_000706269.1.6164 WP_000706269.1.61662 WP_000706269.1.61924 WP_000706269.1.62076 WP_000706269.1.62219 WP_000706269.1.62241 WP_000706269.1.62245 WP_000706269.1.62486 WP_000706269.1.62504 WP_000706269.1.62725 WP_000706269.1.62798 WP_000706269.1.63118 WP_000706269.1.63135 WP_000706269.1.63155 WP_000706269.1.63243 WP_000706269.1.63532 WP_000706269.1.63568 WP_000706269.1.63633 WP_000706269.1.63831 WP_000706269.1.63864 WP_000706269.1.63934 WP_000706269.1.64007 WP_000706269.1.64034 WP_000706269.1.64121 WP_000706269.1.64208 WP_000706269.1.64217 WP_000706269.1.64266 WP_000706269.1.6437 WP_000706269.1.64374 WP_000706269.1.64645 WP_000706269.1.65016 WP_000706269.1.65027 WP_000706269.1.65052 WP_000706269.1.65168 WP_000706269.1.65185 WP_000706269.1.65238 WP_000706269.1.65295 WP_000706269.1.6561 WP_000706269.1.6572 WP_000706269.1.65790 WP_000706269.1.65795 WP_000706269.1.65849 WP_000706269.1.65876 WP_000706269.1.6594 WP_000706269.1.66082 WP_000706269.1.66122 WP_000706269.1.66129 WP_000706269.1.66235 WP_000706269.1.66289 WP_000706269.1.66365 WP_000706269.1.6647 WP_000706269.1.66492 WP_000706269.1.66800 WP_000706269.1.66807 WP_000706269.1.66824 WP_000706269.1.66937 WP_000706269.1.67288 WP_000706269.1.67772 WP_000706269.1.67905 WP_000706269.1.67924 WP_000706269.1.68036 WP_000706269.1.68167 WP_000706269.1.68532 WP_000706269.1.68591 WP_000706269.1.68999 WP_000706269.1.69139 WP_000706269.1.69296 WP_000706269.1.69754 WP_000706269.1.69785 WP_000706269.1.69807 WP_000706269.1.7010 WP_000706269.1.7016 WP_000706269.1.70248 WP_000706269.1.70303 WP_000706269.1.70321 WP_000706269.1.70644 WP_000706269.1.70792 WP_000706269.1.70914 WP_000706269.1.70929 WP_000706269.1.70977 WP_000706269.1.7110 WP_000706269.1.71248 WP_000706269.1.71299 WP_000706269.1.71368 WP_000706269.1.7142 WP_000706269.1.71446 WP_000706269.1.71600 WP_000706269.1.71667 WP_000706269.1.7174 WP_000706269.1.71746 WP_000706269.1.71756 WP_000706269.1.71929 WP_000706269.1.71941 WP_000706269.1.72182 WP_000706269.1.72226 WP_000706269.1.72281 WP_000706269.1.72307 WP_000706269.1.72382 WP_000706269.1.72470 WP_000706269.1.72625 WP_000706269.1.72689 WP_000706269.1.72827 WP_000706269.1.72843 WP_000706269.1.7304 WP_000706269.1.73512 WP_000706269.1.73669 WP_000706269.1.73764 WP_000706269.1.73831 WP_000706269.1.73956 WP_000706269.1.73965 WP_000706269.1.74040 WP_000706269.1.74117 WP_000706269.1.74422 WP_000706269.1.7444 WP_000706269.1.74500 WP_000706269.1.74806 WP_000706269.1.74992 WP_000706269.1.75402 WP_000706269.1.7543 WP_000706269.1.75494 WP_000706269.1.75585 WP_000706269.1.75626 WP_000706269.1.75884 WP_000706269.1.75932 WP_000706269.1.75957 WP_000706269.1.76024 WP_000706269.1.76055 WP_000706269.1.76097 WP_000706269.1.76102 WP_000706269.1.76156 WP_000706269.1.76170 WP_000706269.1.76301 WP_000706269.1.7634 WP_000706269.1.76364 WP_000706269.1.76434 WP_000706269.1.7655 WP_000706269.1.7672 WP_000706269.1.76724 WP_000706269.1.76738 WP_000706269.1.76806 WP_000706269.1.77067 WP_000706269.1.77193 WP_000706269.1.77271 WP_000706269.1.77313 WP_000706269.1.77596 WP_000706269.1.77646 WP_000706269.1.78201 WP_000706269.1.78245 WP_000706269.1.78862 WP_000706269.1.7891 WP_000706269.1.78928 WP_000706269.1.79032 WP_000706269.1.79297 WP_000706269.1.79302 WP_000706269.1.79642 WP_000706269.1.79757 WP_000706269.1.79832 WP_000706269.1.79929 WP_000706269.1.79934 WP_000706269.1.79966 WP_000706269.1.80236 WP_000706269.1.80307 WP_000706269.1.80333 WP_000706269.1.80480 WP_000706269.1.80529 WP_000706269.1.80586 WP_000706269.1.80609 WP_000706269.1.80667 WP_000706269.1.80674 WP_000706269.1.80750 WP_000706269.1.80913 WP_000706269.1.80959 WP_000706269.1.81062 WP_000706269.1.81321 WP_000706269.1.81455 WP_000706269.1.8196 WP_000706269.1.82099 WP_000706269.1.82395 WP_000706269.1.82584 WP_000706269.1.82763 WP_000706269.1.82841 WP_000706269.1.82908 WP_000706269.1.83119 WP_000706269.1.83128 WP_000706269.1.83139 WP_000706269.1.8322 WP_000706269.1.83382 WP_000706269.1.83598 WP_000706269.1.83650 WP_000706269.1.83739 WP_000706269.1.83759 WP_000706269.1.83854 WP_000706269.1.83897 WP_000706269.1.83960 WP_000706269.1.83979 WP_000706269.1.84031 WP_000706269.1.84077 WP_000706269.1.84179 WP_000706269.1.8425 WP_000706269.1.84355 WP_000706269.1.84683 WP_000706269.1.84745 WP_000706269.1.85864 WP_000706269.1.86120 WP_000706269.1.86159 WP_000706269.1.86259 WP_000706269.1.86285 WP_000706269.1.86335 WP_000706269.1.86453 WP_000706269.1.86601 WP_000706269.1.87051 WP_000706269.1.87148 WP_000706269.1.87323 WP_000706269.1.87493 WP_000706269.1.87618 WP_000706269.1.87760 WP_000706269.1.87875 WP_000706269.1.87933 WP_000706269.1.87936 WP_000706269.1.88244 WP_000706269.1.88303 WP_000706269.1.88483 WP_000706269.1.88624 WP_000706269.1.88762 WP_000706269.1.88967 WP_000706269.1.88982 WP_000706269.1.89452 WP_000706269.1.89462 WP_000706269.1.89580 WP_000706269.1.89815 WP_000706269.1.89965 WP_000706269.1.89975 WP_000706269.1.90248 WP_000706269.1.90440 WP_000706269.1.9064 WP_000706269.1.90866 WP_000706269.1.90984 WP_000706269.1.91042 WP_000706269.1.91334 WP_000706269.1.91470 WP_000706269.1.91493 WP_000706269.1.91806 WP_000706269.1.91903 WP_000706269.1.92039 WP_000706269.1.92529 WP_000706269.1.92729 WP_000706269.1.92754 WP_000706269.1.92926 WP_000706269.1.92939 WP_000706269.1.92975 WP_000706269.1.93213 WP_000706269.1.93322 WP_000706269.1.93410 WP_000706269.1.93741 WP_000706269.1.93761 WP_000706269.1.93803 WP_000706269.1.94132 WP_000706269.1.94352 WP_000706269.1.94967 WP_000706269.1.94983 WP_000706269.1.94987 WP_000706269.1.95235 WP_000706269.1.95249 WP_000706269.1.95289 WP_000706269.1.95298 WP_000706269.1.9530 WP_000706269.1.95558 WP_000706269.1.95579 WP_000706269.1.95641 WP_000706269.1.95840 WP_000706269.1.95940 WP_000706269.1.9609 WP_000706269.1.96206 WP_000706269.1.96335 WP_000706269.1.96490 WP_000706269.1.96584 WP_000706269.1.96902 WP_000706269.1.97043 WP_000706269.1.97109 WP_000706269.1.97337 WP_000706269.1.97368 WP_000706269.1.97534 WP_000706269.1.97772 WP_000706269.1.98201 WP_000706269.1.98446 WP_000706269.1.98483 WP_000706269.1.98551 WP_000706269.1.98634 WP_000706269.1.98899 WP_000706269.1.98947 WP_000706269.1.9919 WP_000706269.1.9954 WP_000706269.1.99577 WP_000706269.1.99725 272994.SPAB_01805 439851.SeD_A1834 476213.SPC_2224 ABAN01000003|CDS_255237-254023 ABEH02000002|CDS_236481-237695 ABEW01000001|CDS_510646-509432 ABFG01000001|CDS_748886-747672 CP000857|CDS_2283481-2282267 CP000886|CDS_1539089-1537875 CP001144|CDS_1775851-1774637 gi|161614066|ref|YP_001588031.1| gi|525947357|ref|YP_008308718.1| gi|224583988|ref|YP_002637786.1| gi|525857604|ref|YP_008260694.1| gi|538362087|ref|YP_008505372.1| gi|198244222|ref|YP_002215632.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]