SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 439851.SeD_A3280 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  439851.SeD_A3280
Domain Number 1 Region: 139-415
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.65e-81
Family D-glucarate dehydratase-like 0.0000000000856
Further Details:      
 
Domain Number 2 Region: 8-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.07e-30
Family Enolase N-terminal domain-like 0.000000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 439851.SeD_A3280
Sequence length 446
Comment (Salmonella enterica serovar Dublin CT 02021853)
Sequence
MSTQFTTPVVTEMQVIPVAGHDSMLMNLSGAHAPFFTRNIVIIKDNSGHTGVGEIPGGEK
IRKTLEDAIPLVVGKTLGEYKNVLTAVRNQFADRDAGGRGLQTFDLRTTIHVVTGIEAAM
LDLLGQHLGVNVASLLGDGQQRSEVEMLGYLFFVGNRKATPLPYQSQPDEQCDWYRLRHE
EAMTPETVVRLAEAAYEKYGFNDFKLKGGVLAGEEEAESIVALAKRFPQARVTLDPNGAW
SLNEAISIGKYLKGSLAYAEDPCGAEQGFSGREVMAEFRRATGLPTATNMIATDWRQMGH
TLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFGLTWGSHSNNHFDISLAMFTHVAAAAPG
KITAIDTHWIWQEGNQRLTKEPFEIKGGMVQVPTKPGLGVELDMDQVMKAHELYQKHGLG
ARDDAMGMQYLIPGWTFDNKRPCMVR
Download sequence
Identical sequences A0A0D6IHQ9 A0A0F6B634 A0A0F7JBI9 A0A0H3BP11 A0A0H3NLN2 A0A0M0PYE5 A0A0R9NRZ1 A0A0U0WIZ8 A0A0U1FNT2 A0A1C2ZY53 A0A1S1AM37 A0A1X2V0P0 A0A1Z3Q660 A0A221YPL8 A0A221Z9B6 A0A249UV62 A0A265B2V1 A0A267SM06 A0A271CVK0 A0A2D1Y202 A0A2D3AFU0 A0A2D3TSH3 A0A2G1NK53 A0A2H9YFE6 A0A2I6NMM9 E8X8P4 G4C6E2 M7SFY7 Q57KF6 Q8ZMD9 S4ITU5 S5HK33 V1VW66 V7IHF7 V7UAX2
gi|525837147|ref|YP_008253863.1| gi|194447661|ref|YP_002046929.1| gi|409246651|ref|YP_006887355.1| gi|525858737|ref|YP_008262103.1| gi|16766266|ref|NP_461881.1| gi|378990284|ref|YP_005253448.1| NP_461881.1.58477 WP_000107113.1.100002 WP_000107113.1.100007 WP_000107113.1.100010 WP_000107113.1.100017 WP_000107113.1.100031 WP_000107113.1.100077 WP_000107113.1.100115 WP_000107113.1.100234 WP_000107113.1.100258 WP_000107113.1.100266 WP_000107113.1.100288 WP_000107113.1.100376 WP_000107113.1.100392 WP_000107113.1.100412 WP_000107113.1.100424 WP_000107113.1.100432 WP_000107113.1.100436 WP_000107113.1.100438 WP_000107113.1.100457 WP_000107113.1.100472 WP_000107113.1.100484 WP_000107113.1.100488 WP_000107113.1.100502 WP_000107113.1.100519 WP_000107113.1.100557 WP_000107113.1.100584 WP_000107113.1.100589 WP_000107113.1.100597 WP_000107113.1.100605 WP_000107113.1.10065 WP_000107113.1.100650 WP_000107113.1.100707 WP_000107113.1.100711 WP_000107113.1.100714 WP_000107113.1.100730 WP_000107113.1.10074 WP_000107113.1.10076 WP_000107113.1.100773 WP_000107113.1.100776 WP_000107113.1.100781 WP_000107113.1.100793 WP_000107113.1.10081 WP_000107113.1.100857 WP_000107113.1.100865 WP_000107113.1.100869 WP_000107113.1.100871 WP_000107113.1.100882 WP_000107113.1.100886 WP_000107113.1.100895 WP_000107113.1.100944 WP_000107113.1.100948 WP_000107113.1.101007 WP_000107113.1.101020 WP_000107113.1.101042 WP_000107113.1.101074 WP_000107113.1.101078 WP_000107113.1.101091 WP_000107113.1.101112 WP_000107113.1.101123 WP_000107113.1.101126 WP_000107113.1.101180 WP_000107113.1.101185 WP_000107113.1.101199 WP_000107113.1.101223 WP_000107113.1.101259 WP_000107113.1.101284 WP_000107113.1.101291 WP_000107113.1.1013 WP_000107113.1.101320 WP_000107113.1.101353 WP_000107113.1.101386 WP_000107113.1.101404 WP_000107113.1.101420 WP_000107113.1.101425 WP_000107113.1.101454 WP_000107113.1.101473 WP_000107113.1.101519 WP_000107113.1.101520 WP_000107113.1.101541 WP_000107113.1.101589 WP_000107113.1.101609 WP_000107113.1.101612 WP_000107113.1.101634 WP_000107113.1.101636 WP_000107113.1.101666 WP_000107113.1.101707 WP_000107113.1.101724 WP_000107113.1.101734 WP_000107113.1.101740 WP_000107113.1.101741 WP_000107113.1.101744 WP_000107113.1.101759 WP_000107113.1.10177 WP_000107113.1.101776 WP_000107113.1.101815 WP_000107113.1.101832 WP_000107113.1.101839 WP_000107113.1.101841 WP_000107113.1.101868 WP_000107113.1.101878 WP_000107113.1.10191 WP_000107113.1.101917 WP_000107113.1.101927 WP_000107113.1.101949 WP_000107113.1.101953 WP_000107113.1.102009 WP_000107113.1.102103 WP_000107113.1.102111 WP_000107113.1.10220 WP_000107113.1.10231 WP_000107113.1.10266 WP_000107113.1.10276 WP_000107113.1.10300 WP_000107113.1.10310 WP_000107113.1.10394 WP_000107113.1.10429 WP_000107113.1.10439 WP_000107113.1.10465 WP_000107113.1.10498 WP_000107113.1.10521 WP_000107113.1.10562 WP_000107113.1.10566 WP_000107113.1.10568 WP_000107113.1.10675 WP_000107113.1.10678 WP_000107113.1.10720 WP_000107113.1.10753 WP_000107113.1.10755 WP_000107113.1.10868 WP_000107113.1.10992 WP_000107113.1.11000 WP_000107113.1.11024 WP_000107113.1.11031 WP_000107113.1.11098 WP_000107113.1.1110 WP_000107113.1.11119 WP_000107113.1.11156 WP_000107113.1.11168 WP_000107113.1.11190 WP_000107113.1.11213 WP_000107113.1.11216 WP_000107113.1.11254 WP_000107113.1.11295 WP_000107113.1.11304 WP_000107113.1.1135 WP_000107113.1.1137 WP_000107113.1.11455 WP_000107113.1.11458 WP_000107113.1.11479 WP_000107113.1.1150 WP_000107113.1.11518 WP_000107113.1.11528 WP_000107113.1.11532 WP_000107113.1.11543 WP_000107113.1.1156 WP_000107113.1.11565 WP_000107113.1.11588 WP_000107113.1.11603 WP_000107113.1.11677 WP_000107113.1.11687 WP_000107113.1.11735 WP_000107113.1.1174 WP_000107113.1.11763 WP_000107113.1.11772 WP_000107113.1.11824 WP_000107113.1.11834 WP_000107113.1.11841 WP_000107113.1.11865 WP_000107113.1.11868 WP_000107113.1.11875 WP_000107113.1.11897 WP_000107113.1.11900 WP_000107113.1.11936 WP_000107113.1.11938 WP_000107113.1.11964 WP_000107113.1.11978 WP_000107113.1.12007 WP_000107113.1.12017 WP_000107113.1.12025 WP_000107113.1.12027 WP_000107113.1.12047 WP_000107113.1.12063 WP_000107113.1.12106 WP_000107113.1.12114 WP_000107113.1.12144 WP_000107113.1.1215 WP_000107113.1.12159 WP_000107113.1.12168 WP_000107113.1.12244 WP_000107113.1.12280 WP_000107113.1.12282 WP_000107113.1.12351 WP_000107113.1.12370 WP_000107113.1.1239 WP_000107113.1.12396 WP_000107113.1.12397 WP_000107113.1.12456 WP_000107113.1.1246 WP_000107113.1.12472 WP_000107113.1.12484 WP_000107113.1.1250 WP_000107113.1.12546 WP_000107113.1.12568 WP_000107113.1.12584 WP_000107113.1.1264 WP_000107113.1.12696 WP_000107113.1.12701 WP_000107113.1.12718 WP_000107113.1.12728 WP_000107113.1.12864 WP_000107113.1.12879 WP_000107113.1.12936 WP_000107113.1.12995 WP_000107113.1.1300 WP_000107113.1.13027 WP_000107113.1.13101 WP_000107113.1.13102 WP_000107113.1.13106 WP_000107113.1.13130 WP_000107113.1.13207 WP_000107113.1.13247 WP_000107113.1.1326 WP_000107113.1.13274 WP_000107113.1.13311 WP_000107113.1.13334 WP_000107113.1.13367 WP_000107113.1.13391 WP_000107113.1.13414 WP_000107113.1.13429 WP_000107113.1.1346 WP_000107113.1.13488 WP_000107113.1.13509 WP_000107113.1.13543 WP_000107113.1.13625 WP_000107113.1.13661 WP_000107113.1.13669 WP_000107113.1.13677 WP_000107113.1.13741 WP_000107113.1.13750 WP_000107113.1.13764 WP_000107113.1.13848 WP_000107113.1.13857 WP_000107113.1.1387 WP_000107113.1.13908 WP_000107113.1.13932 WP_000107113.1.13968 WP_000107113.1.14001 WP_000107113.1.14041 WP_000107113.1.14050 WP_000107113.1.14056 WP_000107113.1.14111 WP_000107113.1.1412 WP_000107113.1.14151 WP_000107113.1.14239 WP_000107113.1.14286 WP_000107113.1.14320 WP_000107113.1.14369 WP_000107113.1.14379 WP_000107113.1.1440 WP_000107113.1.14406 WP_000107113.1.14410 WP_000107113.1.14436 WP_000107113.1.14446 WP_000107113.1.14458 WP_000107113.1.14495 WP_000107113.1.14516 WP_000107113.1.14519 WP_000107113.1.14524 WP_000107113.1.14554 WP_000107113.1.14618 WP_000107113.1.14688 WP_000107113.1.14708 WP_000107113.1.14725 WP_000107113.1.14737 WP_000107113.1.14789 WP_000107113.1.14793 WP_000107113.1.14808 WP_000107113.1.14819 WP_000107113.1.14852 WP_000107113.1.14876 WP_000107113.1.14884 WP_000107113.1.1489 WP_000107113.1.14917 WP_000107113.1.14927 WP_000107113.1.14932 WP_000107113.1.14936 WP_000107113.1.14964 WP_000107113.1.15046 WP_000107113.1.15055 WP_000107113.1.15059 WP_000107113.1.15079 WP_000107113.1.15100 WP_000107113.1.15102 WP_000107113.1.15214 WP_000107113.1.15223 WP_000107113.1.15226 WP_000107113.1.15276 WP_000107113.1.15316 WP_000107113.1.15353 WP_000107113.1.15369 WP_000107113.1.1540 WP_000107113.1.15468 WP_000107113.1.15483 WP_000107113.1.15508 WP_000107113.1.1551 WP_000107113.1.15585 WP_000107113.1.15586 WP_000107113.1.15612 WP_000107113.1.15625 WP_000107113.1.15627 WP_000107113.1.15637 WP_000107113.1.15708 WP_000107113.1.15775 WP_000107113.1.15795 WP_000107113.1.158 WP_000107113.1.15830 WP_000107113.1.15835 WP_000107113.1.15862 WP_000107113.1.15909 WP_000107113.1.15910 WP_000107113.1.1592 WP_000107113.1.15922 WP_000107113.1.15986 WP_000107113.1.15995 WP_000107113.1.16000 WP_000107113.1.16004 WP_000107113.1.16006 WP_000107113.1.1601 WP_000107113.1.16028 WP_000107113.1.16032 WP_000107113.1.16047 WP_000107113.1.16062 WP_000107113.1.16063 WP_000107113.1.16103 WP_000107113.1.1611 WP_000107113.1.16125 WP_000107113.1.16172 WP_000107113.1.16226 WP_000107113.1.16233 WP_000107113.1.16273 WP_000107113.1.16284 WP_000107113.1.16328 WP_000107113.1.16331 WP_000107113.1.1635 WP_000107113.1.16361 WP_000107113.1.16363 WP_000107113.1.16366 WP_000107113.1.16394 WP_000107113.1.16453 WP_000107113.1.16468 WP_000107113.1.16474 WP_000107113.1.16508 WP_000107113.1.16525 WP_000107113.1.16551 WP_000107113.1.16565 WP_000107113.1.16581 WP_000107113.1.16614 WP_000107113.1.16650 WP_000107113.1.1668 WP_000107113.1.16686 WP_000107113.1.16691 WP_000107113.1.167 WP_000107113.1.16729 WP_000107113.1.16732 WP_000107113.1.16735 WP_000107113.1.16736 WP_000107113.1.16786 WP_000107113.1.16819 WP_000107113.1.16846 WP_000107113.1.16855 WP_000107113.1.16858 WP_000107113.1.16873 WP_000107113.1.1689 WP_000107113.1.16896 WP_000107113.1.16903 WP_000107113.1.16910 WP_000107113.1.16941 WP_000107113.1.16942 WP_000107113.1.16944 WP_000107113.1.16949 WP_000107113.1.16965 WP_000107113.1.16998 WP_000107113.1.1700 WP_000107113.1.17031 WP_000107113.1.17060 WP_000107113.1.17093 WP_000107113.1.17096 WP_000107113.1.17098 WP_000107113.1.17188 WP_000107113.1.17285 WP_000107113.1.17307 WP_000107113.1.174 WP_000107113.1.17439 WP_000107113.1.17447 WP_000107113.1.17480 WP_000107113.1.1749 WP_000107113.1.17504 WP_000107113.1.17525 WP_000107113.1.17546 WP_000107113.1.17560 WP_000107113.1.1757 WP_000107113.1.17583 WP_000107113.1.17629 WP_000107113.1.17693 WP_000107113.1.17702 WP_000107113.1.17703 WP_000107113.1.17705 WP_000107113.1.17732 WP_000107113.1.17743 WP_000107113.1.17747 WP_000107113.1.17755 WP_000107113.1.17758 WP_000107113.1.17865 WP_000107113.1.17886 WP_000107113.1.17891 WP_000107113.1.17901 WP_000107113.1.17919 WP_000107113.1.17936 WP_000107113.1.1798 WP_000107113.1.17991 WP_000107113.1.18019 WP_000107113.1.18022 WP_000107113.1.18056 WP_000107113.1.18061 WP_000107113.1.18089 WP_000107113.1.18092 WP_000107113.1.18111 WP_000107113.1.18122 WP_000107113.1.18149 WP_000107113.1.18163 WP_000107113.1.18177 WP_000107113.1.1818 WP_000107113.1.18192 WP_000107113.1.18249 WP_000107113.1.1825 WP_000107113.1.18254 WP_000107113.1.18265 WP_000107113.1.18267 WP_000107113.1.18281 WP_000107113.1.18282 WP_000107113.1.18384 WP_000107113.1.18441 WP_000107113.1.18468 WP_000107113.1.18485 WP_000107113.1.18489 WP_000107113.1.18607 WP_000107113.1.18641 WP_000107113.1.18686 WP_000107113.1.18692 WP_000107113.1.18715 WP_000107113.1.18737 WP_000107113.1.18776 WP_000107113.1.18822 WP_000107113.1.18847 WP_000107113.1.18881 WP_000107113.1.18886 WP_000107113.1.18940 WP_000107113.1.18949 WP_000107113.1.1895 WP_000107113.1.1897 WP_000107113.1.18972 WP_000107113.1.19030 WP_000107113.1.19038 WP_000107113.1.19053 WP_000107113.1.19064 WP_000107113.1.19163 WP_000107113.1.19273 WP_000107113.1.19291 WP_000107113.1.19320 WP_000107113.1.19357 WP_000107113.1.19373 WP_000107113.1.1939 WP_000107113.1.19458 WP_000107113.1.19460 WP_000107113.1.19461 WP_000107113.1.1954 WP_000107113.1.1955 WP_000107113.1.19588 WP_000107113.1.19614 WP_000107113.1.19616 WP_000107113.1.19642 WP_000107113.1.19660 WP_000107113.1.1968 WP_000107113.1.19683 WP_000107113.1.19702 WP_000107113.1.19706 WP_000107113.1.19724 WP_000107113.1.19740 WP_000107113.1.19749 WP_000107113.1.19784 WP_000107113.1.19793 WP_000107113.1.19802 WP_000107113.1.19809 WP_000107113.1.19834 WP_000107113.1.19851 WP_000107113.1.19867 WP_000107113.1.19884 WP_000107113.1.1990 WP_000107113.1.19967 WP_000107113.1.19975 WP_000107113.1.1998 WP_000107113.1.19987 WP_000107113.1.20023 WP_000107113.1.20089 WP_000107113.1.2010 WP_000107113.1.20119 WP_000107113.1.20212 WP_000107113.1.20218 WP_000107113.1.2026 WP_000107113.1.20261 WP_000107113.1.20266 WP_000107113.1.20271 WP_000107113.1.20330 WP_000107113.1.20362 WP_000107113.1.20364 WP_000107113.1.20376 WP_000107113.1.20391 WP_000107113.1.2041 WP_000107113.1.20415 WP_000107113.1.20418 WP_000107113.1.20425 WP_000107113.1.20437 WP_000107113.1.20443 WP_000107113.1.20446 WP_000107113.1.20503 WP_000107113.1.20525 WP_000107113.1.2054 WP_000107113.1.20553 WP_000107113.1.20614 WP_000107113.1.20626 WP_000107113.1.20631 WP_000107113.1.20646 WP_000107113.1.20695 WP_000107113.1.20700 WP_000107113.1.20721 WP_000107113.1.20760 WP_000107113.1.20767 WP_000107113.1.20787 WP_000107113.1.20789 WP_000107113.1.20839 WP_000107113.1.20862 WP_000107113.1.20886 WP_000107113.1.20900 WP_000107113.1.20908 WP_000107113.1.2091 WP_000107113.1.21049 WP_000107113.1.2107 WP_000107113.1.21075 WP_000107113.1.21079 WP_000107113.1.21089 WP_000107113.1.21103 WP_000107113.1.21136 WP_000107113.1.21146 WP_000107113.1.2116 WP_000107113.1.21202 WP_000107113.1.21245 WP_000107113.1.21246 WP_000107113.1.21269 WP_000107113.1.21286 WP_000107113.1.2130 WP_000107113.1.21309 WP_000107113.1.21326 WP_000107113.1.21332 WP_000107113.1.21351 WP_000107113.1.21362 WP_000107113.1.21399 WP_000107113.1.21400 WP_000107113.1.21404 WP_000107113.1.21443 WP_000107113.1.21453 WP_000107113.1.2146 WP_000107113.1.21497 WP_000107113.1.21499 WP_000107113.1.21548 WP_000107113.1.21603 WP_000107113.1.21616 WP_000107113.1.21681 WP_000107113.1.21692 WP_000107113.1.21730 WP_000107113.1.21751 WP_000107113.1.21757 WP_000107113.1.21792 WP_000107113.1.21825 WP_000107113.1.21845 WP_000107113.1.21877 WP_000107113.1.21886 WP_000107113.1.21909 WP_000107113.1.21910 WP_000107113.1.21940 WP_000107113.1.21950 WP_000107113.1.21981 WP_000107113.1.21991 WP_000107113.1.22019 WP_000107113.1.22024 WP_000107113.1.22030 WP_000107113.1.2205 WP_000107113.1.22051 WP_000107113.1.22062 WP_000107113.1.22067 WP_000107113.1.22096 WP_000107113.1.22136 WP_000107113.1.22158 WP_000107113.1.22162 WP_000107113.1.22169 WP_000107113.1.22205 WP_000107113.1.2221 WP_000107113.1.22235 WP_000107113.1.22240 WP_000107113.1.22270 WP_000107113.1.22296 WP_000107113.1.22337 WP_000107113.1.22346 WP_000107113.1.2235 WP_000107113.1.22379 WP_000107113.1.22427 WP_000107113.1.22449 WP_000107113.1.2246 WP_000107113.1.22460 WP_000107113.1.22485 WP_000107113.1.22514 WP_000107113.1.22537 WP_000107113.1.22565 WP_000107113.1.22582 WP_000107113.1.22590 WP_000107113.1.22595 WP_000107113.1.22620 WP_000107113.1.22676 WP_000107113.1.22692 WP_000107113.1.22758 WP_000107113.1.22760 WP_000107113.1.2283 WP_000107113.1.22845 WP_000107113.1.22857 WP_000107113.1.22864 WP_000107113.1.22870 WP_000107113.1.22880 WP_000107113.1.22947 WP_000107113.1.22979 WP_000107113.1.23114 WP_000107113.1.2314 WP_000107113.1.23148 WP_000107113.1.23155 WP_000107113.1.23169 WP_000107113.1.23172 WP_000107113.1.23175 WP_000107113.1.23192 WP_000107113.1.2324 WP_000107113.1.23246 WP_000107113.1.23259 WP_000107113.1.23274 WP_000107113.1.23279 WP_000107113.1.23309 WP_000107113.1.23311 WP_000107113.1.23329 WP_000107113.1.23343 WP_000107113.1.23379 WP_000107113.1.23409 WP_000107113.1.2342 WP_000107113.1.23442 WP_000107113.1.23444 WP_000107113.1.23460 WP_000107113.1.23472 WP_000107113.1.235 WP_000107113.1.23500 WP_000107113.1.23503 WP_000107113.1.23509 WP_000107113.1.23513 WP_000107113.1.23529 WP_000107113.1.2358 WP_000107113.1.23631 WP_000107113.1.23634 WP_000107113.1.23639 WP_000107113.1.2364 WP_000107113.1.23643 WP_000107113.1.23646 WP_000107113.1.23670 WP_000107113.1.23685 WP_000107113.1.237 WP_000107113.1.23707 WP_000107113.1.23720 WP_000107113.1.23736 WP_000107113.1.23755 WP_000107113.1.2376 WP_000107113.1.2380 WP_000107113.1.23819 WP_000107113.1.23932 WP_000107113.1.23959 WP_000107113.1.24017 WP_000107113.1.24082 WP_000107113.1.24145 WP_000107113.1.2415 WP_000107113.1.24163 WP_000107113.1.24206 WP_000107113.1.24250 WP_000107113.1.24259 WP_000107113.1.24297 WP_000107113.1.24303 WP_000107113.1.24308 WP_000107113.1.24361 WP_000107113.1.24376 WP_000107113.1.24392 WP_000107113.1.24408 WP_000107113.1.24409 WP_000107113.1.24419 WP_000107113.1.24433 WP_000107113.1.24444 WP_000107113.1.24450 WP_000107113.1.24476 WP_000107113.1.24494 WP_000107113.1.24555 WP_000107113.1.24567 WP_000107113.1.24578 WP_000107113.1.2467 WP_000107113.1.24686 WP_000107113.1.24689 WP_000107113.1.24696 WP_000107113.1.24723 WP_000107113.1.24737 WP_000107113.1.24779 WP_000107113.1.24803 WP_000107113.1.24839 WP_000107113.1.24901 WP_000107113.1.24944 WP_000107113.1.24995 WP_000107113.1.25008 WP_000107113.1.25015 WP_000107113.1.25036 WP_000107113.1.25064 WP_000107113.1.25072 WP_000107113.1.25119 WP_000107113.1.25130 WP_000107113.1.25159 WP_000107113.1.25175 WP_000107113.1.25206 WP_000107113.1.2525 WP_000107113.1.25297 WP_000107113.1.25354 WP_000107113.1.25405 WP_000107113.1.25421 WP_000107113.1.25426 WP_000107113.1.25454 WP_000107113.1.25493 WP_000107113.1.25498 WP_000107113.1.2554 WP_000107113.1.25546 WP_000107113.1.25564 WP_000107113.1.25668 WP_000107113.1.2568 WP_000107113.1.25690 WP_000107113.1.2570 WP_000107113.1.25700 WP_000107113.1.25703 WP_000107113.1.25709 WP_000107113.1.25722 WP_000107113.1.25740 WP_000107113.1.25780 WP_000107113.1.25793 WP_000107113.1.25809 WP_000107113.1.2581 WP_000107113.1.25814 WP_000107113.1.25825 WP_000107113.1.25928 WP_000107113.1.25932 WP_000107113.1.25951 WP_000107113.1.25988 WP_000107113.1.26030 WP_000107113.1.26034 WP_000107113.1.26083 WP_000107113.1.26194 WP_000107113.1.26269 WP_000107113.1.26282 WP_000107113.1.26311 WP_000107113.1.26319 WP_000107113.1.2634 WP_000107113.1.26363 WP_000107113.1.26384 WP_000107113.1.26426 WP_000107113.1.26429 WP_000107113.1.26440 WP_000107113.1.26441 WP_000107113.1.26493 WP_000107113.1.26512 WP_000107113.1.26532 WP_000107113.1.26551 WP_000107113.1.26567 WP_000107113.1.26582 WP_000107113.1.26587 WP_000107113.1.2660 WP_000107113.1.2667 WP_000107113.1.26687 WP_000107113.1.2672 WP_000107113.1.26741 WP_000107113.1.26787 WP_000107113.1.26794 WP_000107113.1.26856 WP_000107113.1.26882 WP_000107113.1.26892 WP_000107113.1.26919 WP_000107113.1.26924 WP_000107113.1.26936 WP_000107113.1.26980 WP_000107113.1.27010 WP_000107113.1.27051 WP_000107113.1.27055 WP_000107113.1.27072 WP_000107113.1.27084 WP_000107113.1.27122 WP_000107113.1.27173 WP_000107113.1.27206 WP_000107113.1.27223 WP_000107113.1.27255 WP_000107113.1.27272 WP_000107113.1.27314 WP_000107113.1.27342 WP_000107113.1.27383 WP_000107113.1.27419 WP_000107113.1.27423 WP_000107113.1.27452 WP_000107113.1.27513 WP_000107113.1.27523 WP_000107113.1.27535 WP_000107113.1.27544 WP_000107113.1.27547 WP_000107113.1.27556 WP_000107113.1.27561 WP_000107113.1.27616 WP_000107113.1.2763 WP_000107113.1.27632 WP_000107113.1.27638 WP_000107113.1.27658 WP_000107113.1.27665 WP_000107113.1.27707 WP_000107113.1.27713 WP_000107113.1.27755 WP_000107113.1.27761 WP_000107113.1.2777 WP_000107113.1.27776 WP_000107113.1.27798 WP_000107113.1.27800 WP_000107113.1.27815 WP_000107113.1.27833 WP_000107113.1.27857 WP_000107113.1.27883 WP_000107113.1.27995 WP_000107113.1.27997 WP_000107113.1.28032 WP_000107113.1.28037 WP_000107113.1.28056 WP_000107113.1.28073 WP_000107113.1.28094 WP_000107113.1.28116 WP_000107113.1.28126 WP_000107113.1.28139 WP_000107113.1.28170 WP_000107113.1.28200 WP_000107113.1.28225 WP_000107113.1.28232 WP_000107113.1.28233 WP_000107113.1.28235 WP_000107113.1.2825 WP_000107113.1.28267 WP_000107113.1.2829 WP_000107113.1.28301 WP_000107113.1.28302 WP_000107113.1.28303 WP_000107113.1.2835 WP_000107113.1.28370 WP_000107113.1.28393 WP_000107113.1.28462 WP_000107113.1.28504 WP_000107113.1.2853 WP_000107113.1.28538 WP_000107113.1.28570 WP_000107113.1.28575 WP_000107113.1.28612 WP_000107113.1.28620 WP_000107113.1.28625 WP_000107113.1.28655 WP_000107113.1.28673 WP_000107113.1.28694 WP_000107113.1.287 WP_000107113.1.28773 WP_000107113.1.28775 WP_000107113.1.28776 WP_000107113.1.2879 WP_000107113.1.28830 WP_000107113.1.2890 WP_000107113.1.28938 WP_000107113.1.28946 WP_000107113.1.28948 WP_000107113.1.29006 WP_000107113.1.29010 WP_000107113.1.29099 WP_000107113.1.2910 WP_000107113.1.29113 WP_000107113.1.29130 WP_000107113.1.29168 WP_000107113.1.29218 WP_000107113.1.2924 WP_000107113.1.29255 WP_000107113.1.29274 WP_000107113.1.2932 WP_000107113.1.29349 WP_000107113.1.29379 WP_000107113.1.29422 WP_000107113.1.29436 WP_000107113.1.29509 WP_000107113.1.29576 WP_000107113.1.29588 WP_000107113.1.29601 WP_000107113.1.29606 WP_000107113.1.29615 WP_000107113.1.29619 WP_000107113.1.29682 WP_000107113.1.29704 WP_000107113.1.29768 WP_000107113.1.29775 WP_000107113.1.29827 WP_000107113.1.2984 WP_000107113.1.29845 WP_000107113.1.29898 WP_000107113.1.29923 WP_000107113.1.29924 WP_000107113.1.29969 WP_000107113.1.29990 WP_000107113.1.30006 WP_000107113.1.30018 WP_000107113.1.30022 WP_000107113.1.30027 WP_000107113.1.3005 WP_000107113.1.30059 WP_000107113.1.30093 WP_000107113.1.3017 WP_000107113.1.30170 WP_000107113.1.30179 WP_000107113.1.30180 WP_000107113.1.30195 WP_000107113.1.30202 WP_000107113.1.30210 WP_000107113.1.30238 WP_000107113.1.30246 WP_000107113.1.30278 WP_000107113.1.30386 WP_000107113.1.30389 WP_000107113.1.30425 WP_000107113.1.30437 WP_000107113.1.30469 WP_000107113.1.30492 WP_000107113.1.30505 WP_000107113.1.30507 WP_000107113.1.30535 WP_000107113.1.30547 WP_000107113.1.30548 WP_000107113.1.30589 WP_000107113.1.30602 WP_000107113.1.30619 WP_000107113.1.30627 WP_000107113.1.3067 WP_000107113.1.3068 WP_000107113.1.30794 WP_000107113.1.3080 WP_000107113.1.30802 WP_000107113.1.30803 WP_000107113.1.30819 WP_000107113.1.30823 WP_000107113.1.30833 WP_000107113.1.30835 WP_000107113.1.30909 WP_000107113.1.30934 WP_000107113.1.30972 WP_000107113.1.31 WP_000107113.1.31001 WP_000107113.1.31011 WP_000107113.1.31042 WP_000107113.1.31086 WP_000107113.1.31092 WP_000107113.1.31111 WP_000107113.1.31122 WP_000107113.1.3113 WP_000107113.1.3114 WP_000107113.1.31156 WP_000107113.1.31167 WP_000107113.1.31171 WP_000107113.1.31185 WP_000107113.1.3119 WP_000107113.1.31190 WP_000107113.1.31195 WP_000107113.1.31196 WP_000107113.1.31198 WP_000107113.1.31210 WP_000107113.1.31214 WP_000107113.1.31219 WP_000107113.1.31222 WP_000107113.1.3124 WP_000107113.1.31251 WP_000107113.1.31262 WP_000107113.1.31281 WP_000107113.1.31362 WP_000107113.1.31435 WP_000107113.1.31451 WP_000107113.1.31476 WP_000107113.1.31504 WP_000107113.1.31515 WP_000107113.1.31578 WP_000107113.1.31658 WP_000107113.1.31665 WP_000107113.1.3167 WP_000107113.1.3170 WP_000107113.1.31720 WP_000107113.1.31725 WP_000107113.1.31762 WP_000107113.1.31845 WP_000107113.1.31854 WP_000107113.1.31895 WP_000107113.1.31927 WP_000107113.1.31940 WP_000107113.1.31952 WP_000107113.1.31967 WP_000107113.1.31972 WP_000107113.1.31983 WP_000107113.1.32006 WP_000107113.1.32056 WP_000107113.1.32109 WP_000107113.1.32116 WP_000107113.1.32170 WP_000107113.1.32192 WP_000107113.1.32204 WP_000107113.1.32206 WP_000107113.1.32252 WP_000107113.1.32260 WP_000107113.1.32274 WP_000107113.1.32275 WP_000107113.1.32277 WP_000107113.1.32309 WP_000107113.1.32368 WP_000107113.1.32408 WP_000107113.1.32423 WP_000107113.1.32424 WP_000107113.1.32434 WP_000107113.1.32438 WP_000107113.1.32491 WP_000107113.1.32493 WP_000107113.1.32515 WP_000107113.1.32527 WP_000107113.1.32545 WP_000107113.1.32624 WP_000107113.1.32629 WP_000107113.1.32660 WP_000107113.1.32668 WP_000107113.1.32702 WP_000107113.1.32714 WP_000107113.1.32740 WP_000107113.1.32786 WP_000107113.1.32804 WP_000107113.1.32832 WP_000107113.1.32860 WP_000107113.1.32881 WP_000107113.1.32902 WP_000107113.1.32907 WP_000107113.1.32930 WP_000107113.1.32961 WP_000107113.1.32977 WP_000107113.1.33010 WP_000107113.1.33030 WP_000107113.1.33078 WP_000107113.1.33106 WP_000107113.1.33127 WP_000107113.1.33143 WP_000107113.1.33160 WP_000107113.1.33248 WP_000107113.1.33261 WP_000107113.1.33270 WP_000107113.1.333 WP_000107113.1.33409 WP_000107113.1.33486 WP_000107113.1.33492 WP_000107113.1.33499 WP_000107113.1.335 WP_000107113.1.33553 WP_000107113.1.3356 WP_000107113.1.33580 WP_000107113.1.33586 WP_000107113.1.33592 WP_000107113.1.3364 WP_000107113.1.33659 WP_000107113.1.33693 WP_000107113.1.33817 WP_000107113.1.33825 WP_000107113.1.33865 WP_000107113.1.33870 WP_000107113.1.33894 WP_000107113.1.3394 WP_000107113.1.3395 WP_000107113.1.3396 WP_000107113.1.33986 WP_000107113.1.34 WP_000107113.1.34043 WP_000107113.1.34075 WP_000107113.1.34081 WP_000107113.1.34091 WP_000107113.1.34107 WP_000107113.1.34126 WP_000107113.1.34179 WP_000107113.1.34185 WP_000107113.1.34257 WP_000107113.1.34259 WP_000107113.1.34279 WP_000107113.1.34292 WP_000107113.1.34304 WP_000107113.1.34319 WP_000107113.1.3438 WP_000107113.1.34417 WP_000107113.1.3445 WP_000107113.1.34453 WP_000107113.1.34454 WP_000107113.1.34496 WP_000107113.1.34614 WP_000107113.1.34659 WP_000107113.1.34667 WP_000107113.1.34684 WP_000107113.1.34703 WP_000107113.1.34704 WP_000107113.1.34707 WP_000107113.1.34711 WP_000107113.1.3476 WP_000107113.1.34801 WP_000107113.1.34817 WP_000107113.1.34820 WP_000107113.1.34854 WP_000107113.1.3489 WP_000107113.1.34972 WP_000107113.1.34975 WP_000107113.1.34977 WP_000107113.1.35035 WP_000107113.1.35045 WP_000107113.1.35075 WP_000107113.1.35129 WP_000107113.1.35184 WP_000107113.1.35193 WP_000107113.1.35298 WP_000107113.1.35321 WP_000107113.1.35332 WP_000107113.1.35404 WP_000107113.1.35408 WP_000107113.1.3541 WP_000107113.1.35425 WP_000107113.1.35429 WP_000107113.1.35446 WP_000107113.1.35463 WP_000107113.1.35494 WP_000107113.1.35503 WP_000107113.1.35509 WP_000107113.1.3556 WP_000107113.1.35563 WP_000107113.1.35570 WP_000107113.1.35590 WP_000107113.1.35619 WP_000107113.1.35624 WP_000107113.1.35648 WP_000107113.1.3566 WP_000107113.1.3572 WP_000107113.1.35777 WP_000107113.1.35809 WP_000107113.1.35868 WP_000107113.1.35892 WP_000107113.1.35936 WP_000107113.1.35940 WP_000107113.1.35961 WP_000107113.1.36003 WP_000107113.1.3601 WP_000107113.1.36011 WP_000107113.1.36017 WP_000107113.1.36063 WP_000107113.1.36157 WP_000107113.1.36172 WP_000107113.1.36236 WP_000107113.1.36286 WP_000107113.1.36409 WP_000107113.1.36445 WP_000107113.1.36512 WP_000107113.1.36542 WP_000107113.1.36547 WP_000107113.1.36564 WP_000107113.1.36584 WP_000107113.1.36609 WP_000107113.1.36690 WP_000107113.1.3670 WP_000107113.1.36705 WP_000107113.1.36721 WP_000107113.1.36751 WP_000107113.1.36764 WP_000107113.1.36765 WP_000107113.1.36792 WP_000107113.1.36839 WP_000107113.1.3688 WP_000107113.1.36899 WP_000107113.1.36918 WP_000107113.1.36931 WP_000107113.1.36948 WP_000107113.1.36949 WP_000107113.1.36978 WP_000107113.1.37013 WP_000107113.1.37029 WP_000107113.1.37063 WP_000107113.1.37073 WP_000107113.1.37111 WP_000107113.1.37112 WP_000107113.1.37190 WP_000107113.1.37256 WP_000107113.1.3726 WP_000107113.1.37267 WP_000107113.1.37293 WP_000107113.1.37297 WP_000107113.1.37320 WP_000107113.1.3734 WP_000107113.1.37351 WP_000107113.1.37363 WP_000107113.1.37370 WP_000107113.1.37376 WP_000107113.1.3744 WP_000107113.1.37478 WP_000107113.1.3748 WP_000107113.1.37498 WP_000107113.1.37504 WP_000107113.1.3751 WP_000107113.1.37521 WP_000107113.1.37558 WP_000107113.1.3756 WP_000107113.1.37610 WP_000107113.1.37618 WP_000107113.1.37666 WP_000107113.1.37687 WP_000107113.1.3771 WP_000107113.1.37719 WP_000107113.1.3778 WP_000107113.1.37864 WP_000107113.1.3790 WP_000107113.1.37965 WP_000107113.1.37968 WP_000107113.1.37978 WP_000107113.1.38001 WP_000107113.1.38026 WP_000107113.1.38037 WP_000107113.1.38047 WP_000107113.1.38125 WP_000107113.1.38145 WP_000107113.1.38199 WP_000107113.1.38273 WP_000107113.1.383 WP_000107113.1.38322 WP_000107113.1.38344 WP_000107113.1.38349 WP_000107113.1.38393 WP_000107113.1.3848 WP_000107113.1.38512 WP_000107113.1.38569 WP_000107113.1.38609 WP_000107113.1.38613 WP_000107113.1.38622 WP_000107113.1.38673 WP_000107113.1.3869 WP_000107113.1.38693 WP_000107113.1.38740 WP_000107113.1.38773 WP_000107113.1.38781 WP_000107113.1.38797 WP_000107113.1.38830 WP_000107113.1.38857 WP_000107113.1.38881 WP_000107113.1.38882 WP_000107113.1.38895 WP_000107113.1.3891 WP_000107113.1.38913 WP_000107113.1.38942 WP_000107113.1.39003 WP_000107113.1.39038 WP_000107113.1.39055 WP_000107113.1.39065 WP_000107113.1.39113 WP_000107113.1.39136 WP_000107113.1.39140 WP_000107113.1.39183 WP_000107113.1.39197 WP_000107113.1.39229 WP_000107113.1.39265 WP_000107113.1.39275 WP_000107113.1.39312 WP_000107113.1.39385 WP_000107113.1.39395 WP_000107113.1.39405 WP_000107113.1.39414 WP_000107113.1.39420 WP_000107113.1.39449 WP_000107113.1.39471 WP_000107113.1.39497 WP_000107113.1.39503 WP_000107113.1.39512 WP_000107113.1.39553 WP_000107113.1.39556 WP_000107113.1.39576 WP_000107113.1.39584 WP_000107113.1.39609 WP_000107113.1.39614 WP_000107113.1.39629 WP_000107113.1.39632 WP_000107113.1.39723 WP_000107113.1.39724 WP_000107113.1.39763 WP_000107113.1.39808 WP_000107113.1.39862 WP_000107113.1.39921 WP_000107113.1.39923 WP_000107113.1.40008 WP_000107113.1.40017 WP_000107113.1.40025 WP_000107113.1.40072 WP_000107113.1.40073 WP_000107113.1.40081 WP_000107113.1.4011 WP_000107113.1.40111 WP_000107113.1.40158 WP_000107113.1.40170 WP_000107113.1.40205 WP_000107113.1.40208 WP_000107113.1.40224 WP_000107113.1.40229 WP_000107113.1.40240 WP_000107113.1.40257 WP_000107113.1.40258 WP_000107113.1.40259 WP_000107113.1.40292 WP_000107113.1.40305 WP_000107113.1.40307 WP_000107113.1.40311 WP_000107113.1.40341 WP_000107113.1.40374 WP_000107113.1.40395 WP_000107113.1.40465 WP_000107113.1.40492 WP_000107113.1.40493 WP_000107113.1.40508 WP_000107113.1.40528 WP_000107113.1.40533 WP_000107113.1.40577 WP_000107113.1.40583 WP_000107113.1.40622 WP_000107113.1.40695 WP_000107113.1.40710 WP_000107113.1.40722 WP_000107113.1.40745 WP_000107113.1.40771 WP_000107113.1.40788 WP_000107113.1.40849 WP_000107113.1.4087 WP_000107113.1.40877 WP_000107113.1.40930 WP_000107113.1.40935 WP_000107113.1.40979 WP_000107113.1.40996 WP_000107113.1.41017 WP_000107113.1.41018 WP_000107113.1.41048 WP_000107113.1.41050 WP_000107113.1.41086 WP_000107113.1.41091 WP_000107113.1.41116 WP_000107113.1.41128 WP_000107113.1.41192 WP_000107113.1.41226 WP_000107113.1.41277 WP_000107113.1.41279 WP_000107113.1.41299 WP_000107113.1.41310 WP_000107113.1.41345 WP_000107113.1.4141 WP_000107113.1.41427 WP_000107113.1.41434 WP_000107113.1.41438 WP_000107113.1.41440 WP_000107113.1.41516 WP_000107113.1.41528 WP_000107113.1.41554 WP_000107113.1.41591 WP_000107113.1.41593 WP_000107113.1.41610 WP_000107113.1.41662 WP_000107113.1.41688 WP_000107113.1.41690 WP_000107113.1.41708 WP_000107113.1.41724 WP_000107113.1.41735 WP_000107113.1.41761 WP_000107113.1.41859 WP_000107113.1.41862 WP_000107113.1.41877 WP_000107113.1.41882 WP_000107113.1.41904 WP_000107113.1.41931 WP_000107113.1.41938 WP_000107113.1.41979 WP_000107113.1.41985 WP_000107113.1.41994 WP_000107113.1.41998 WP_000107113.1.42009 WP_000107113.1.42104 WP_000107113.1.42109 WP_000107113.1.42156 WP_000107113.1.422 WP_000107113.1.4222 WP_000107113.1.42238 WP_000107113.1.42243 WP_000107113.1.42244 WP_000107113.1.42248 WP_000107113.1.42262 WP_000107113.1.42263 WP_000107113.1.42276 WP_000107113.1.42320 WP_000107113.1.42322 WP_000107113.1.42328 WP_000107113.1.42342 WP_000107113.1.4239 WP_000107113.1.42392 WP_000107113.1.42404 WP_000107113.1.42422 WP_000107113.1.42433 WP_000107113.1.42444 WP_000107113.1.42489 WP_000107113.1.42491 WP_000107113.1.4257 WP_000107113.1.42605 WP_000107113.1.42655 WP_000107113.1.42666 WP_000107113.1.42675 WP_000107113.1.42676 WP_000107113.1.42683 WP_000107113.1.42685 WP_000107113.1.42707 WP_000107113.1.42734 WP_000107113.1.4276 WP_000107113.1.42767 WP_000107113.1.42794 WP_000107113.1.42797 WP_000107113.1.42829 WP_000107113.1.42861 WP_000107113.1.42864 WP_000107113.1.4288 WP_000107113.1.42887 WP_000107113.1.4289 WP_000107113.1.42892 WP_000107113.1.42923 WP_000107113.1.42932 WP_000107113.1.42957 WP_000107113.1.42981 WP_000107113.1.43018 WP_000107113.1.43041 WP_000107113.1.43086 WP_000107113.1.43089 WP_000107113.1.43149 WP_000107113.1.43201 WP_000107113.1.43244 WP_000107113.1.43258 WP_000107113.1.43272 WP_000107113.1.43276 WP_000107113.1.43299 WP_000107113.1.43312 WP_000107113.1.4332 WP_000107113.1.43339 WP_000107113.1.43351 WP_000107113.1.43371 WP_000107113.1.43437 WP_000107113.1.43438 WP_000107113.1.4344 WP_000107113.1.43441 WP_000107113.1.43508 WP_000107113.1.43520 WP_000107113.1.43522 WP_000107113.1.43528 WP_000107113.1.43535 WP_000107113.1.43613 WP_000107113.1.43668 WP_000107113.1.43685 WP_000107113.1.43710 WP_000107113.1.43711 WP_000107113.1.4373 WP_000107113.1.43763 WP_000107113.1.43778 WP_000107113.1.43782 WP_000107113.1.43785 WP_000107113.1.43839 WP_000107113.1.43864 WP_000107113.1.43873 WP_000107113.1.43875 WP_000107113.1.43886 WP_000107113.1.43951 WP_000107113.1.44005 WP_000107113.1.44010 WP_000107113.1.44043 WP_000107113.1.4405 WP_000107113.1.44063 WP_000107113.1.44099 WP_000107113.1.44113 WP_000107113.1.44121 WP_000107113.1.4422 WP_000107113.1.4423 WP_000107113.1.44250 WP_000107113.1.44291 WP_000107113.1.44300 WP_000107113.1.44310 WP_000107113.1.44337 WP_000107113.1.44359 WP_000107113.1.44386 WP_000107113.1.44397 WP_000107113.1.4440 WP_000107113.1.44433 WP_000107113.1.44438 WP_000107113.1.44440 WP_000107113.1.44443 WP_000107113.1.44479 WP_000107113.1.44578 WP_000107113.1.44593 WP_000107113.1.44607 WP_000107113.1.44633 WP_000107113.1.44640 WP_000107113.1.4467 WP_000107113.1.44678 WP_000107113.1.44702 WP_000107113.1.44705 WP_000107113.1.44747 WP_000107113.1.44781 WP_000107113.1.44831 WP_000107113.1.44833 WP_000107113.1.4485 WP_000107113.1.44877 WP_000107113.1.44887 WP_000107113.1.449 WP_000107113.1.44927 WP_000107113.1.44933 WP_000107113.1.44943 WP_000107113.1.44950 WP_000107113.1.44966 WP_000107113.1.44971 WP_000107113.1.44978 WP_000107113.1.44985 WP_000107113.1.44996 WP_000107113.1.44997 WP_000107113.1.44998 WP_000107113.1.4500 WP_000107113.1.45027 WP_000107113.1.45038 WP_000107113.1.45045 WP_000107113.1.45067 WP_000107113.1.45074 WP_000107113.1.45079 WP_000107113.1.45098 WP_000107113.1.45123 WP_000107113.1.45145 WP_000107113.1.45173 WP_000107113.1.45177 WP_000107113.1.45184 WP_000107113.1.45229 WP_000107113.1.45259 WP_000107113.1.45302 WP_000107113.1.4531 WP_000107113.1.45322 WP_000107113.1.45344 WP_000107113.1.45349 WP_000107113.1.45365 WP_000107113.1.4540 WP_000107113.1.45434 WP_000107113.1.45468 WP_000107113.1.45535 WP_000107113.1.45544 WP_000107113.1.45549 WP_000107113.1.45550 WP_000107113.1.45566 WP_000107113.1.45569 WP_000107113.1.45571 WP_000107113.1.45582 WP_000107113.1.45583 WP_000107113.1.45585 WP_000107113.1.45622 WP_000107113.1.45660 WP_000107113.1.45690 WP_000107113.1.45781 WP_000107113.1.45797 WP_000107113.1.458 WP_000107113.1.45848 WP_000107113.1.45906 WP_000107113.1.45918 WP_000107113.1.4592 WP_000107113.1.46011 WP_000107113.1.46069 WP_000107113.1.46112 WP_000107113.1.46124 WP_000107113.1.46173 WP_000107113.1.46174 WP_000107113.1.46187 WP_000107113.1.46203 WP_000107113.1.46205 WP_000107113.1.46215 WP_000107113.1.46232 WP_000107113.1.46243 WP_000107113.1.46250 WP_000107113.1.46278 WP_000107113.1.46286 WP_000107113.1.46303 WP_000107113.1.46322 WP_000107113.1.46323 WP_000107113.1.46345 WP_000107113.1.46406 WP_000107113.1.46434 WP_000107113.1.46444 WP_000107113.1.46572 WP_000107113.1.46574 WP_000107113.1.46595 WP_000107113.1.46620 WP_000107113.1.46666 WP_000107113.1.46675 WP_000107113.1.46689 WP_000107113.1.46693 WP_000107113.1.4671 WP_000107113.1.46726 WP_000107113.1.46730 WP_000107113.1.46732 WP_000107113.1.46749 WP_000107113.1.46803 WP_000107113.1.46804 WP_000107113.1.4686 WP_000107113.1.46930 WP_000107113.1.46961 WP_000107113.1.46976 WP_000107113.1.47008 WP_000107113.1.47014 WP_000107113.1.47057 WP_000107113.1.47067 WP_000107113.1.47214 WP_000107113.1.47257 WP_000107113.1.47389 WP_000107113.1.47429 WP_000107113.1.47442 WP_000107113.1.47448 WP_000107113.1.4747 WP_000107113.1.47472 WP_000107113.1.47478 WP_000107113.1.47482 WP_000107113.1.47492 WP_000107113.1.47506 WP_000107113.1.47507 WP_000107113.1.47567 WP_000107113.1.47576 WP_000107113.1.47579 WP_000107113.1.47621 WP_000107113.1.47649 WP_000107113.1.4770 WP_000107113.1.47714 WP_000107113.1.4775 WP_000107113.1.47799 WP_000107113.1.47814 WP_000107113.1.47817 WP_000107113.1.47849 WP_000107113.1.47850 WP_000107113.1.47875 WP_000107113.1.47902 WP_000107113.1.47911 WP_000107113.1.47928 WP_000107113.1.4795 WP_000107113.1.47992 WP_000107113.1.48124 WP_000107113.1.48132 WP_000107113.1.48209 WP_000107113.1.48215 WP_000107113.1.48218 WP_000107113.1.48242 WP_000107113.1.48247 WP_000107113.1.48253 WP_000107113.1.48268 WP_000107113.1.483 WP_000107113.1.48367 WP_000107113.1.48377 WP_000107113.1.4839 WP_000107113.1.48455 WP_000107113.1.48493 WP_000107113.1.4853 WP_000107113.1.48570 WP_000107113.1.48651 WP_000107113.1.48755 WP_000107113.1.48774 WP_000107113.1.48788 WP_000107113.1.48876 WP_000107113.1.48894 WP_000107113.1.48918 WP_000107113.1.48919 WP_000107113.1.48931 WP_000107113.1.48985 WP_000107113.1.49012 WP_000107113.1.49084 WP_000107113.1.49102 WP_000107113.1.49113 WP_000107113.1.49155 WP_000107113.1.49162 WP_000107113.1.49175 WP_000107113.1.49204 WP_000107113.1.49226 WP_000107113.1.49233 WP_000107113.1.49239 WP_000107113.1.49256 WP_000107113.1.49262 WP_000107113.1.49276 WP_000107113.1.49290 WP_000107113.1.49309 WP_000107113.1.49311 WP_000107113.1.49334 WP_000107113.1.49340 WP_000107113.1.49366 WP_000107113.1.49375 WP_000107113.1.49472 WP_000107113.1.49490 WP_000107113.1.49515 WP_000107113.1.49550 WP_000107113.1.49572 WP_000107113.1.49574 WP_000107113.1.49590 WP_000107113.1.49602 WP_000107113.1.49626 WP_000107113.1.49650 WP_000107113.1.49686 WP_000107113.1.49770 WP_000107113.1.49778 WP_000107113.1.49780 WP_000107113.1.4979 WP_000107113.1.49803 WP_000107113.1.49805 WP_000107113.1.49848 WP_000107113.1.49929 WP_000107113.1.49931 WP_000107113.1.50 WP_000107113.1.50003 WP_000107113.1.50007 WP_000107113.1.50080 WP_000107113.1.5009 WP_000107113.1.50128 WP_000107113.1.50161 WP_000107113.1.50198 WP_000107113.1.50211 WP_000107113.1.50239 WP_000107113.1.50251 WP_000107113.1.50285 WP_000107113.1.50349 WP_000107113.1.50374 WP_000107113.1.50376 WP_000107113.1.50386 WP_000107113.1.50389 WP_000107113.1.50404 WP_000107113.1.50413 WP_000107113.1.50449 WP_000107113.1.50478 WP_000107113.1.50497 WP_000107113.1.50565 WP_000107113.1.50576 WP_000107113.1.5058 WP_000107113.1.50593 WP_000107113.1.50652 WP_000107113.1.50676 WP_000107113.1.50769 WP_000107113.1.50774 WP_000107113.1.50777 WP_000107113.1.50782 WP_000107113.1.50800 WP_000107113.1.50804 WP_000107113.1.50808 WP_000107113.1.50811 WP_000107113.1.5088 WP_000107113.1.50882 WP_000107113.1.50905 WP_000107113.1.50908 WP_000107113.1.50918 WP_000107113.1.50941 WP_000107113.1.50954 WP_000107113.1.50960 WP_000107113.1.50999 WP_000107113.1.51014 WP_000107113.1.51022 WP_000107113.1.51025 WP_000107113.1.51066 WP_000107113.1.51117 WP_000107113.1.51131 WP_000107113.1.51139 WP_000107113.1.5114 WP_000107113.1.51162 WP_000107113.1.51178 WP_000107113.1.51179 WP_000107113.1.51182 WP_000107113.1.51186 WP_000107113.1.51224 WP_000107113.1.51285 WP_000107113.1.51331 WP_000107113.1.51338 WP_000107113.1.51356 WP_000107113.1.51394 WP_000107113.1.51412 WP_000107113.1.51419 WP_000107113.1.51451 WP_000107113.1.51464 WP_000107113.1.51487 WP_000107113.1.51488 WP_000107113.1.51502 WP_000107113.1.51506 WP_000107113.1.51514 WP_000107113.1.51555 WP_000107113.1.51594 WP_000107113.1.51611 WP_000107113.1.51613 WP_000107113.1.51634 WP_000107113.1.51642 WP_000107113.1.51649 WP_000107113.1.51686 WP_000107113.1.51700 WP_000107113.1.51756 WP_000107113.1.51764 WP_000107113.1.51810 WP_000107113.1.51831 WP_000107113.1.51841 WP_000107113.1.51868 WP_000107113.1.51888 WP_000107113.1.51900 WP_000107113.1.51911 WP_000107113.1.51914 WP_000107113.1.51930 WP_000107113.1.51932 WP_000107113.1.51989 WP_000107113.1.51994 WP_000107113.1.520 WP_000107113.1.52047 WP_000107113.1.5211 WP_000107113.1.52121 WP_000107113.1.52123 WP_000107113.1.52148 WP_000107113.1.52156 WP_000107113.1.5216 WP_000107113.1.52161 WP_000107113.1.52170 WP_000107113.1.52255 WP_000107113.1.52301 WP_000107113.1.52321 WP_000107113.1.52346 WP_000107113.1.52353 WP_000107113.1.52356 WP_000107113.1.52361 WP_000107113.1.52438 WP_000107113.1.52527 WP_000107113.1.52528 WP_000107113.1.52586 WP_000107113.1.52608 WP_000107113.1.52653 WP_000107113.1.52656 WP_000107113.1.52675 WP_000107113.1.52692 WP_000107113.1.5273 WP_000107113.1.52743 WP_000107113.1.52744 WP_000107113.1.52824 WP_000107113.1.52833 WP_000107113.1.52851 WP_000107113.1.52857 WP_000107113.1.52858 WP_000107113.1.52866 WP_000107113.1.52898 WP_000107113.1.52915 WP_000107113.1.52924 WP_000107113.1.52949 WP_000107113.1.52985 WP_000107113.1.53100 WP_000107113.1.5313 WP_000107113.1.53158 WP_000107113.1.5316 WP_000107113.1.53179 WP_000107113.1.53190 WP_000107113.1.53198 WP_000107113.1.53203 WP_000107113.1.53206 WP_000107113.1.53234 WP_000107113.1.53272 WP_000107113.1.53286 WP_000107113.1.53316 WP_000107113.1.5333 WP_000107113.1.53362 WP_000107113.1.53385 WP_000107113.1.53406 WP_000107113.1.53436 WP_000107113.1.53454 WP_000107113.1.53466 WP_000107113.1.53529 WP_000107113.1.53534 WP_000107113.1.53543 WP_000107113.1.53567 WP_000107113.1.53664 WP_000107113.1.53675 WP_000107113.1.53688 WP_000107113.1.53694 WP_000107113.1.53696 WP_000107113.1.53757 WP_000107113.1.53772 WP_000107113.1.53778 WP_000107113.1.53812 WP_000107113.1.53896 WP_000107113.1.53905 WP_000107113.1.53935 WP_000107113.1.53961 WP_000107113.1.54033 WP_000107113.1.54061 WP_000107113.1.54075 WP_000107113.1.54082 WP_000107113.1.54136 WP_000107113.1.54159 WP_000107113.1.54196 WP_000107113.1.542 WP_000107113.1.54209 WP_000107113.1.54271 WP_000107113.1.54273 WP_000107113.1.54274 WP_000107113.1.54319 WP_000107113.1.54333 WP_000107113.1.54364 WP_000107113.1.54366 WP_000107113.1.54400 WP_000107113.1.54469 WP_000107113.1.54522 WP_000107113.1.54526 WP_000107113.1.54558 WP_000107113.1.5456 WP_000107113.1.54569 WP_000107113.1.54607 WP_000107113.1.54644 WP_000107113.1.54662 WP_000107113.1.54694 WP_000107113.1.54722 WP_000107113.1.54749 WP_000107113.1.54764 WP_000107113.1.54774 WP_000107113.1.54814 WP_000107113.1.54822 WP_000107113.1.54833 WP_000107113.1.54845 WP_000107113.1.5485 WP_000107113.1.54877 WP_000107113.1.5493 WP_000107113.1.54984 WP_000107113.1.55008 WP_000107113.1.55073 WP_000107113.1.55152 WP_000107113.1.55156 WP_000107113.1.5517 WP_000107113.1.55223 WP_000107113.1.55224 WP_000107113.1.5523 WP_000107113.1.5527 WP_000107113.1.55285 WP_000107113.1.55294 WP_000107113.1.55325 WP_000107113.1.55418 WP_000107113.1.55430 WP_000107113.1.55461 WP_000107113.1.55475 WP_000107113.1.55477 WP_000107113.1.55496 WP_000107113.1.55545 WP_000107113.1.5555 WP_000107113.1.55554 WP_000107113.1.55557 WP_000107113.1.5560 WP_000107113.1.55614 WP_000107113.1.55623 WP_000107113.1.55647 WP_000107113.1.55672 WP_000107113.1.55680 WP_000107113.1.55706 WP_000107113.1.55718 WP_000107113.1.5572 WP_000107113.1.55743 WP_000107113.1.55768 WP_000107113.1.5577 WP_000107113.1.55782 WP_000107113.1.55796 WP_000107113.1.55803 WP_000107113.1.55853 WP_000107113.1.55923 WP_000107113.1.55973 WP_000107113.1.55993 WP_000107113.1.56002 WP_000107113.1.56004 WP_000107113.1.56012 WP_000107113.1.56026 WP_000107113.1.56059 WP_000107113.1.56082 WP_000107113.1.56097 WP_000107113.1.56100 WP_000107113.1.56105 WP_000107113.1.56222 WP_000107113.1.56235 WP_000107113.1.56238 WP_000107113.1.56244 WP_000107113.1.56247 WP_000107113.1.56261 WP_000107113.1.56263 WP_000107113.1.56286 WP_000107113.1.56303 WP_000107113.1.56304 WP_000107113.1.56305 WP_000107113.1.56368 WP_000107113.1.56370 WP_000107113.1.56385 WP_000107113.1.56389 WP_000107113.1.56393 WP_000107113.1.56414 WP_000107113.1.56420 WP_000107113.1.56438 WP_000107113.1.56468 WP_000107113.1.56512 WP_000107113.1.56559 WP_000107113.1.56560 WP_000107113.1.56597 WP_000107113.1.56601 WP_000107113.1.56614 WP_000107113.1.56615 WP_000107113.1.56647 WP_000107113.1.56651 WP_000107113.1.56660 WP_000107113.1.56671 WP_000107113.1.5668 WP_000107113.1.56682 WP_000107113.1.56853 WP_000107113.1.56861 WP_000107113.1.56875 WP_000107113.1.56877 WP_000107113.1.56893 WP_000107113.1.56898 WP_000107113.1.56905 WP_000107113.1.56950 WP_000107113.1.57000 WP_000107113.1.57026 WP_000107113.1.57039 WP_000107113.1.57084 WP_000107113.1.5711 WP_000107113.1.57125 WP_000107113.1.57143 WP_000107113.1.57149 WP_000107113.1.57168 WP_000107113.1.57187 WP_000107113.1.57232 WP_000107113.1.57233 WP_000107113.1.57246 WP_000107113.1.57296 WP_000107113.1.57307 WP_000107113.1.57356 WP_000107113.1.57357 WP_000107113.1.57377 WP_000107113.1.57399 WP_000107113.1.57418 WP_000107113.1.57433 WP_000107113.1.57494 WP_000107113.1.57510 WP_000107113.1.57515 WP_000107113.1.57529 WP_000107113.1.5753 WP_000107113.1.57534 WP_000107113.1.57555 WP_000107113.1.57559 WP_000107113.1.57576 WP_000107113.1.57601 WP_000107113.1.57607 WP_000107113.1.57641 WP_000107113.1.57709 WP_000107113.1.57735 WP_000107113.1.5774 WP_000107113.1.57763 WP_000107113.1.57778 WP_000107113.1.57797 WP_000107113.1.5781 WP_000107113.1.57835 WP_000107113.1.57862 WP_000107113.1.57890 WP_000107113.1.57891 WP_000107113.1.57893 WP_000107113.1.57902 WP_000107113.1.57978 WP_000107113.1.5801 WP_000107113.1.58040 WP_000107113.1.58041 WP_000107113.1.58090 WP_000107113.1.58131 WP_000107113.1.58144 WP_000107113.1.58153 WP_000107113.1.58157 WP_000107113.1.58249 WP_000107113.1.5828 WP_000107113.1.58301 WP_000107113.1.58357 WP_000107113.1.58358 WP_000107113.1.58372 WP_000107113.1.58407 WP_000107113.1.58416 WP_000107113.1.58418 WP_000107113.1.58442 WP_000107113.1.58443 WP_000107113.1.58451 WP_000107113.1.5846 WP_000107113.1.58486 WP_000107113.1.58489 WP_000107113.1.5854 WP_000107113.1.58548 WP_000107113.1.5858 WP_000107113.1.58604 WP_000107113.1.58633 WP_000107113.1.58662 WP_000107113.1.58669 WP_000107113.1.58675 WP_000107113.1.58698 WP_000107113.1.587 WP_000107113.1.58729 WP_000107113.1.58745 WP_000107113.1.58749 WP_000107113.1.5878 WP_000107113.1.58803 WP_000107113.1.58831 WP_000107113.1.58834 WP_000107113.1.58836 WP_000107113.1.5886 WP_000107113.1.58861 WP_000107113.1.58884 WP_000107113.1.58932 WP_000107113.1.59012 WP_000107113.1.59084 WP_000107113.1.59094 WP_000107113.1.59097 WP_000107113.1.59125 WP_000107113.1.59136 WP_000107113.1.59142 WP_000107113.1.59148 WP_000107113.1.59163 WP_000107113.1.59224 WP_000107113.1.59295 WP_000107113.1.59335 WP_000107113.1.59336 WP_000107113.1.59375 WP_000107113.1.59381 WP_000107113.1.59412 WP_000107113.1.59420 WP_000107113.1.59427 WP_000107113.1.59439 WP_000107113.1.59458 WP_000107113.1.59490 WP_000107113.1.59508 WP_000107113.1.59512 WP_000107113.1.59521 WP_000107113.1.5953 WP_000107113.1.59538 WP_000107113.1.59548 WP_000107113.1.59604 WP_000107113.1.59636 WP_000107113.1.59641 WP_000107113.1.59646 WP_000107113.1.59684 WP_000107113.1.59694 WP_000107113.1.59710 WP_000107113.1.59771 WP_000107113.1.5979 WP_000107113.1.59830 WP_000107113.1.59848 WP_000107113.1.59928 WP_000107113.1.5993 WP_000107113.1.59953 WP_000107113.1.60004 WP_000107113.1.60008 WP_000107113.1.60015 WP_000107113.1.60021 WP_000107113.1.60052 WP_000107113.1.60069 WP_000107113.1.60106 WP_000107113.1.60137 WP_000107113.1.60140 WP_000107113.1.60155 WP_000107113.1.60209 WP_000107113.1.60213 WP_000107113.1.60226 WP_000107113.1.60231 WP_000107113.1.60285 WP_000107113.1.6033 WP_000107113.1.60330 WP_000107113.1.60379 WP_000107113.1.60425 WP_000107113.1.60464 WP_000107113.1.60486 WP_000107113.1.60507 WP_000107113.1.6052 WP_000107113.1.60545 WP_000107113.1.60560 WP_000107113.1.60561 WP_000107113.1.60597 WP_000107113.1.60608 WP_000107113.1.60643 WP_000107113.1.60661 WP_000107113.1.60713 WP_000107113.1.60760 WP_000107113.1.60772 WP_000107113.1.60794 WP_000107113.1.60838 WP_000107113.1.60851 WP_000107113.1.60857 WP_000107113.1.6086 WP_000107113.1.60866 WP_000107113.1.60874 WP_000107113.1.6090 WP_000107113.1.60919 WP_000107113.1.60926 WP_000107113.1.60941 WP_000107113.1.60976 WP_000107113.1.60988 WP_000107113.1.60990 WP_000107113.1.61045 WP_000107113.1.61078 WP_000107113.1.6108 WP_000107113.1.61087 WP_000107113.1.61114 WP_000107113.1.6114 WP_000107113.1.61146 WP_000107113.1.61184 WP_000107113.1.61201 WP_000107113.1.61232 WP_000107113.1.61233 WP_000107113.1.6129 WP_000107113.1.61296 WP_000107113.1.61345 WP_000107113.1.61356 WP_000107113.1.61381 WP_000107113.1.61417 WP_000107113.1.61434 WP_000107113.1.61497 WP_000107113.1.61501 WP_000107113.1.61509 WP_000107113.1.61582 WP_000107113.1.61594 WP_000107113.1.61609 WP_000107113.1.6164 WP_000107113.1.61662 WP_000107113.1.61667 WP_000107113.1.61712 WP_000107113.1.61714 WP_000107113.1.61730 WP_000107113.1.61732 WP_000107113.1.61743 WP_000107113.1.61783 WP_000107113.1.61857 WP_000107113.1.61918 WP_000107113.1.61922 WP_000107113.1.61924 WP_000107113.1.61952 WP_000107113.1.61968 WP_000107113.1.62007 WP_000107113.1.62020 WP_000107113.1.62025 WP_000107113.1.62076 WP_000107113.1.6209 WP_000107113.1.6210 WP_000107113.1.62120 WP_000107113.1.62122 WP_000107113.1.62201 WP_000107113.1.62204 WP_000107113.1.62210 WP_000107113.1.62219 WP_000107113.1.62222 WP_000107113.1.62241 WP_000107113.1.62245 WP_000107113.1.62257 WP_000107113.1.62271 WP_000107113.1.62304 WP_000107113.1.62339 WP_000107113.1.62344 WP_000107113.1.62361 WP_000107113.1.62364 WP_000107113.1.62374 WP_000107113.1.62403 WP_000107113.1.62404 WP_000107113.1.62486 WP_000107113.1.62504 WP_000107113.1.62522 WP_000107113.1.6253 WP_000107113.1.62564 WP_000107113.1.62570 WP_000107113.1.62619 WP_000107113.1.62648 WP_000107113.1.62677 WP_000107113.1.627 WP_000107113.1.62798 WP_000107113.1.62853 WP_000107113.1.62903 WP_000107113.1.62910 WP_000107113.1.6292 WP_000107113.1.62955 WP_000107113.1.62976 WP_000107113.1.62983 WP_000107113.1.62988 WP_000107113.1.63043 WP_000107113.1.63045 WP_000107113.1.63063 WP_000107113.1.63102 WP_000107113.1.63118 WP_000107113.1.63129 WP_000107113.1.63135 WP_000107113.1.63150 WP_000107113.1.63155 WP_000107113.1.63186 WP_000107113.1.63203 WP_000107113.1.63229 WP_000107113.1.63234 WP_000107113.1.63243 WP_000107113.1.63256 WP_000107113.1.63290 WP_000107113.1.63358 WP_000107113.1.63382 WP_000107113.1.63422 WP_000107113.1.63432 WP_000107113.1.63455 WP_000107113.1.63461 WP_000107113.1.63479 WP_000107113.1.63509 WP_000107113.1.63513 WP_000107113.1.63525 WP_000107113.1.63529 WP_000107113.1.63532 WP_000107113.1.6357 WP_000107113.1.63577 WP_000107113.1.63585 WP_000107113.1.63603 WP_000107113.1.63664 WP_000107113.1.6367 WP_000107113.1.63677 WP_000107113.1.6370 WP_000107113.1.63718 WP_000107113.1.63748 WP_000107113.1.6375 WP_000107113.1.63781 WP_000107113.1.63797 WP_000107113.1.63831 WP_000107113.1.63834 WP_000107113.1.63851 WP_000107113.1.63863 WP_000107113.1.63864 WP_000107113.1.63866 WP_000107113.1.63903 WP_000107113.1.63934 WP_000107113.1.63977 WP_000107113.1.6399 WP_000107113.1.63992 WP_000107113.1.64007 WP_000107113.1.64010 WP_000107113.1.64018 WP_000107113.1.64034 WP_000107113.1.64046 WP_000107113.1.64085 WP_000107113.1.64109 WP_000107113.1.64121 WP_000107113.1.64208 WP_000107113.1.64229 WP_000107113.1.6423 WP_000107113.1.64242 WP_000107113.1.64244 WP_000107113.1.64266 WP_000107113.1.64350 WP_000107113.1.6437 WP_000107113.1.64374 WP_000107113.1.64385 WP_000107113.1.64387 WP_000107113.1.64403 WP_000107113.1.64412 WP_000107113.1.64462 WP_000107113.1.64569 WP_000107113.1.64597 WP_000107113.1.64649 WP_000107113.1.64667 WP_000107113.1.64674 WP_000107113.1.64690 WP_000107113.1.64702 WP_000107113.1.64711 WP_000107113.1.64757 WP_000107113.1.64781 WP_000107113.1.64798 WP_000107113.1.64831 WP_000107113.1.6489 WP_000107113.1.64894 WP_000107113.1.64919 WP_000107113.1.64920 WP_000107113.1.64944 WP_000107113.1.64972 WP_000107113.1.64977 WP_000107113.1.65011 WP_000107113.1.65018 WP_000107113.1.65022 WP_000107113.1.65027 WP_000107113.1.65028 WP_000107113.1.65052 WP_000107113.1.65163 WP_000107113.1.65168 WP_000107113.1.65171 WP_000107113.1.65185 WP_000107113.1.65238 WP_000107113.1.65248 WP_000107113.1.6525 WP_000107113.1.65269 WP_000107113.1.65348 WP_000107113.1.6535 WP_000107113.1.65357 WP_000107113.1.65363 WP_000107113.1.65394 WP_000107113.1.65437 WP_000107113.1.65474 WP_000107113.1.6550 WP_000107113.1.65538 WP_000107113.1.65558 WP_000107113.1.65572 WP_000107113.1.6560 WP_000107113.1.65601 WP_000107113.1.6561 WP_000107113.1.65633 WP_000107113.1.6565 WP_000107113.1.65696 WP_000107113.1.65698 WP_000107113.1.6572 WP_000107113.1.6575 WP_000107113.1.65771 WP_000107113.1.65782 WP_000107113.1.65795 WP_000107113.1.65838 WP_000107113.1.65849 WP_000107113.1.65876 WP_000107113.1.65881 WP_000107113.1.65883 WP_000107113.1.65901 WP_000107113.1.6594 WP_000107113.1.65940 WP_000107113.1.6595 WP_000107113.1.65956 WP_000107113.1.65968 WP_000107113.1.66049 WP_000107113.1.66074 WP_000107113.1.66122 WP_000107113.1.66129 WP_000107113.1.66167 WP_000107113.1.66171 WP_000107113.1.66235 WP_000107113.1.66250 WP_000107113.1.66270 WP_000107113.1.66272 WP_000107113.1.66289 WP_000107113.1.6630 WP_000107113.1.66314 WP_000107113.1.66315 WP_000107113.1.66330 WP_000107113.1.66362 WP_000107113.1.66365 WP_000107113.1.66368 WP_000107113.1.6638 WP_000107113.1.66385 WP_000107113.1.6640 WP_000107113.1.66446 WP_000107113.1.66462 WP_000107113.1.6647 WP_000107113.1.66492 WP_000107113.1.66534 WP_000107113.1.66539 WP_000107113.1.66600 WP_000107113.1.66678 WP_000107113.1.66698 WP_000107113.1.66702 WP_000107113.1.66733 WP_000107113.1.6680 WP_000107113.1.66820 WP_000107113.1.66825 WP_000107113.1.66834 WP_000107113.1.66876 WP_000107113.1.66901 WP_000107113.1.6692 WP_000107113.1.66937 WP_000107113.1.66959 WP_000107113.1.66962 WP_000107113.1.67 WP_000107113.1.67037 WP_000107113.1.67045 WP_000107113.1.67100 WP_000107113.1.67173 WP_000107113.1.67181 WP_000107113.1.67184 WP_000107113.1.67235 WP_000107113.1.67268 WP_000107113.1.67279 WP_000107113.1.67288 WP_000107113.1.67347 WP_000107113.1.67374 WP_000107113.1.6739 WP_000107113.1.67424 WP_000107113.1.67465 WP_000107113.1.67552 WP_000107113.1.6760 WP_000107113.1.67617 WP_000107113.1.67633 WP_000107113.1.67637 WP_000107113.1.67682 WP_000107113.1.67707 WP_000107113.1.67772 WP_000107113.1.67776 WP_000107113.1.67803 WP_000107113.1.6782 WP_000107113.1.67827 WP_000107113.1.67829 WP_000107113.1.6785 WP_000107113.1.67887 WP_000107113.1.67905 WP_000107113.1.67924 WP_000107113.1.67932 WP_000107113.1.67970 WP_000107113.1.67977 WP_000107113.1.68036 WP_000107113.1.68073 WP_000107113.1.6809 WP_000107113.1.68115 WP_000107113.1.68140 WP_000107113.1.68147 WP_000107113.1.68201 WP_000107113.1.68206 WP_000107113.1.68210 WP_000107113.1.6827 WP_000107113.1.68275 WP_000107113.1.68401 WP_000107113.1.68477 WP_000107113.1.68478 WP_000107113.1.6849 WP_000107113.1.685 WP_000107113.1.68532 WP_000107113.1.68547 WP_000107113.1.6858 WP_000107113.1.68589 WP_000107113.1.68591 WP_000107113.1.68652 WP_000107113.1.68655 WP_000107113.1.68656 WP_000107113.1.68677 WP_000107113.1.6869 WP_000107113.1.68690 WP_000107113.1.6875 WP_000107113.1.68778 WP_000107113.1.68787 WP_000107113.1.6879 WP_000107113.1.68816 WP_000107113.1.68818 WP_000107113.1.6882 WP_000107113.1.6883 WP_000107113.1.68893 WP_000107113.1.68894 WP_000107113.1.68895 WP_000107113.1.68928 WP_000107113.1.68958 WP_000107113.1.68975 WP_000107113.1.68999 WP_000107113.1.69001 WP_000107113.1.69006 WP_000107113.1.69011 WP_000107113.1.6904 WP_000107113.1.6905 WP_000107113.1.69058 WP_000107113.1.6907 WP_000107113.1.69080 WP_000107113.1.69086 WP_000107113.1.6913 WP_000107113.1.69131 WP_000107113.1.69146 WP_000107113.1.69151 WP_000107113.1.69236 WP_000107113.1.69255 WP_000107113.1.69273 WP_000107113.1.69288 WP_000107113.1.69296 WP_000107113.1.69320 WP_000107113.1.69346 WP_000107113.1.69357 WP_000107113.1.69359 WP_000107113.1.69371 WP_000107113.1.69385 WP_000107113.1.69397 WP_000107113.1.69465 WP_000107113.1.69485 WP_000107113.1.6954 WP_000107113.1.69564 WP_000107113.1.69575 WP_000107113.1.69588 WP_000107113.1.69597 WP_000107113.1.69616 WP_000107113.1.69636 WP_000107113.1.69644 WP_000107113.1.69696 WP_000107113.1.69704 WP_000107113.1.69710 WP_000107113.1.69754 WP_000107113.1.69758 WP_000107113.1.69760 WP_000107113.1.69767 WP_000107113.1.69785 WP_000107113.1.69790 WP_000107113.1.69807 WP_000107113.1.69808 WP_000107113.1.69848 WP_000107113.1.69890 WP_000107113.1.69965 WP_000107113.1.69975 WP_000107113.1.69982 WP_000107113.1.70047 WP_000107113.1.70088 WP_000107113.1.7010 WP_000107113.1.7014 WP_000107113.1.7016 WP_000107113.1.7021 WP_000107113.1.70241 WP_000107113.1.70269 WP_000107113.1.70272 WP_000107113.1.70289 WP_000107113.1.70303 WP_000107113.1.70321 WP_000107113.1.70326 WP_000107113.1.70440 WP_000107113.1.70447 WP_000107113.1.70485 WP_000107113.1.70488 WP_000107113.1.70491 WP_000107113.1.70523 WP_000107113.1.70531 WP_000107113.1.70547 WP_000107113.1.7055 WP_000107113.1.70580 WP_000107113.1.70596 WP_000107113.1.70643 WP_000107113.1.70644 WP_000107113.1.70678 WP_000107113.1.70683 WP_000107113.1.70712 WP_000107113.1.70732 WP_000107113.1.70733 WP_000107113.1.70785 WP_000107113.1.70792 WP_000107113.1.70797 WP_000107113.1.70837 WP_000107113.1.70869 WP_000107113.1.70883 WP_000107113.1.70914 WP_000107113.1.70922 WP_000107113.1.70929 WP_000107113.1.70948 WP_000107113.1.70959 WP_000107113.1.70969 WP_000107113.1.70971 WP_000107113.1.70977 WP_000107113.1.70985 WP_000107113.1.71007 WP_000107113.1.71010 WP_000107113.1.71023 WP_000107113.1.71069 WP_000107113.1.71116 WP_000107113.1.71120 WP_000107113.1.71146 WP_000107113.1.71150 WP_000107113.1.71165 WP_000107113.1.71172 WP_000107113.1.71184 WP_000107113.1.71188 WP_000107113.1.71201 WP_000107113.1.71202 WP_000107113.1.71243 WP_000107113.1.71248 WP_000107113.1.71268 WP_000107113.1.71299 WP_000107113.1.71305 WP_000107113.1.71306 WP_000107113.1.71337 WP_000107113.1.7134 WP_000107113.1.71363 WP_000107113.1.71368 WP_000107113.1.71378 WP_000107113.1.71401 WP_000107113.1.71418 WP_000107113.1.7142 WP_000107113.1.71452 WP_000107113.1.71481 WP_000107113.1.71600 WP_000107113.1.71626 WP_000107113.1.71636 WP_000107113.1.71691 WP_000107113.1.71702 WP_000107113.1.7174 WP_000107113.1.71746 WP_000107113.1.71750 WP_000107113.1.71756 WP_000107113.1.71798 WP_000107113.1.71845 WP_000107113.1.71881 WP_000107113.1.71908 WP_000107113.1.71923 WP_000107113.1.71929 WP_000107113.1.71941 WP_000107113.1.71952 WP_000107113.1.71973 WP_000107113.1.71979 WP_000107113.1.71984 WP_000107113.1.72065 WP_000107113.1.72068 WP_000107113.1.72100 WP_000107113.1.72105 WP_000107113.1.72107 WP_000107113.1.72182 WP_000107113.1.72188 WP_000107113.1.72190 WP_000107113.1.72203 WP_000107113.1.72220 WP_000107113.1.72221 WP_000107113.1.72226 WP_000107113.1.72281 WP_000107113.1.72283 WP_000107113.1.72300 WP_000107113.1.72307 WP_000107113.1.72351 WP_000107113.1.72372 WP_000107113.1.72376 WP_000107113.1.72403 WP_000107113.1.7243 WP_000107113.1.72470 WP_000107113.1.72532 WP_000107113.1.72594 WP_000107113.1.72602 WP_000107113.1.72625 WP_000107113.1.72716 WP_000107113.1.72718 WP_000107113.1.72728 WP_000107113.1.72827 WP_000107113.1.72843 WP_000107113.1.72865 WP_000107113.1.72871 WP_000107113.1.72872 WP_000107113.1.72887 WP_000107113.1.72892 WP_000107113.1.72944 WP_000107113.1.7295 WP_000107113.1.72968 WP_000107113.1.72975 WP_000107113.1.7304 WP_000107113.1.73062 WP_000107113.1.73125 WP_000107113.1.73144 WP_000107113.1.7315 WP_000107113.1.73200 WP_000107113.1.73270 WP_000107113.1.73328 WP_000107113.1.7334 WP_000107113.1.73362 WP_000107113.1.73377 WP_000107113.1.73379 WP_000107113.1.7341 WP_000107113.1.73461 WP_000107113.1.73481 WP_000107113.1.73512 WP_000107113.1.73535 WP_000107113.1.7356 WP_000107113.1.73561 WP_000107113.1.73581 WP_000107113.1.73596 WP_000107113.1.73617 WP_000107113.1.73667 WP_000107113.1.73669 WP_000107113.1.73701 WP_000107113.1.73708 WP_000107113.1.7374 WP_000107113.1.73753 WP_000107113.1.73758 WP_000107113.1.73764 WP_000107113.1.73794 WP_000107113.1.73831 WP_000107113.1.73847 WP_000107113.1.7386 WP_000107113.1.7387 WP_000107113.1.73901 WP_000107113.1.73924 WP_000107113.1.73926 WP_000107113.1.7394 WP_000107113.1.73945 WP_000107113.1.73956 WP_000107113.1.73965 WP_000107113.1.74028 WP_000107113.1.74029 WP_000107113.1.74040 WP_000107113.1.74049 WP_000107113.1.74117 WP_000107113.1.74174 WP_000107113.1.74181 WP_000107113.1.74191 WP_000107113.1.74207 WP_000107113.1.74248 WP_000107113.1.743 WP_000107113.1.74300 WP_000107113.1.7433 WP_000107113.1.74379 WP_000107113.1.74402 WP_000107113.1.74410 WP_000107113.1.74418 WP_000107113.1.74422 WP_000107113.1.7444 WP_000107113.1.74466 WP_000107113.1.745 WP_000107113.1.74529 WP_000107113.1.74545 WP_000107113.1.74570 WP_000107113.1.74578 WP_000107113.1.7458 WP_000107113.1.74632 WP_000107113.1.74639 WP_000107113.1.74644 WP_000107113.1.74661 WP_000107113.1.74702 WP_000107113.1.74745 WP_000107113.1.74806 WP_000107113.1.74807 WP_000107113.1.74826 WP_000107113.1.7491 WP_000107113.1.74946 WP_000107113.1.74972 WP_000107113.1.74992 WP_000107113.1.74996 WP_000107113.1.75009 WP_000107113.1.75051 WP_000107113.1.75056 WP_000107113.1.75058 WP_000107113.1.75114 WP_000107113.1.75129 WP_000107113.1.75134 WP_000107113.1.75159 WP_000107113.1.75177 WP_000107113.1.75180 WP_000107113.1.75187 WP_000107113.1.75288 WP_000107113.1.75334 WP_000107113.1.75362 WP_000107113.1.75385 WP_000107113.1.75392 WP_000107113.1.75400 WP_000107113.1.75402 WP_000107113.1.7543 WP_000107113.1.75450 WP_000107113.1.75494 WP_000107113.1.7558 WP_000107113.1.75585 WP_000107113.1.75607 WP_000107113.1.75609 WP_000107113.1.75626 WP_000107113.1.75664 WP_000107113.1.75703 WP_000107113.1.75716 WP_000107113.1.75740 WP_000107113.1.75751 WP_000107113.1.75760 WP_000107113.1.75764 WP_000107113.1.75793 WP_000107113.1.75794 WP_000107113.1.75828 WP_000107113.1.75837 WP_000107113.1.75873 WP_000107113.1.75874 WP_000107113.1.75884 WP_000107113.1.75902 WP_000107113.1.75932 WP_000107113.1.75945 WP_000107113.1.75957 WP_000107113.1.76 WP_000107113.1.76020 WP_000107113.1.76024 WP_000107113.1.76055 WP_000107113.1.76097 WP_000107113.1.76102 WP_000107113.1.76108 WP_000107113.1.76137 WP_000107113.1.76156 WP_000107113.1.76162 WP_000107113.1.76164 WP_000107113.1.76170 WP_000107113.1.76186 WP_000107113.1.76197 WP_000107113.1.76208 WP_000107113.1.76252 WP_000107113.1.7629 WP_000107113.1.76301 WP_000107113.1.76327 WP_000107113.1.7633 WP_000107113.1.7634 WP_000107113.1.76345 WP_000107113.1.76364 WP_000107113.1.76434 WP_000107113.1.76445 WP_000107113.1.76532 WP_000107113.1.76548 WP_000107113.1.7657 WP_000107113.1.76576 WP_000107113.1.7660 WP_000107113.1.76673 WP_000107113.1.76706 WP_000107113.1.7672 WP_000107113.1.76721 WP_000107113.1.76724 WP_000107113.1.76738 WP_000107113.1.76756 WP_000107113.1.76760 WP_000107113.1.76776 WP_000107113.1.76806 WP_000107113.1.76875 WP_000107113.1.76880 WP_000107113.1.76899 WP_000107113.1.76913 WP_000107113.1.76968 WP_000107113.1.77038 WP_000107113.1.77047 WP_000107113.1.77067 WP_000107113.1.77080 WP_000107113.1.7712 WP_000107113.1.77177 WP_000107113.1.77180 WP_000107113.1.77184 WP_000107113.1.77193 WP_000107113.1.77244 WP_000107113.1.77267 WP_000107113.1.77271 WP_000107113.1.77292 WP_000107113.1.77306 WP_000107113.1.77313 WP_000107113.1.77356 WP_000107113.1.77414 WP_000107113.1.77431 WP_000107113.1.77440 WP_000107113.1.77475 WP_000107113.1.77514 WP_000107113.1.77543 WP_000107113.1.77549 WP_000107113.1.77555 WP_000107113.1.77565 WP_000107113.1.77575 WP_000107113.1.77596 WP_000107113.1.77629 WP_000107113.1.77646 WP_000107113.1.77692 WP_000107113.1.77710 WP_000107113.1.77729 WP_000107113.1.77761 WP_000107113.1.7782 WP_000107113.1.77846 WP_000107113.1.77918 WP_000107113.1.7792 WP_000107113.1.7793 WP_000107113.1.77951 WP_000107113.1.77960 WP_000107113.1.77971 WP_000107113.1.77987 WP_000107113.1.77989 WP_000107113.1.78016 WP_000107113.1.7802 WP_000107113.1.78026 WP_000107113.1.78051 WP_000107113.1.78053 WP_000107113.1.78076 WP_000107113.1.78096 WP_000107113.1.78100 WP_000107113.1.78110 WP_000107113.1.78120 WP_000107113.1.78168 WP_000107113.1.78170 WP_000107113.1.78180 WP_000107113.1.78201 WP_000107113.1.78245 WP_000107113.1.78259 WP_000107113.1.78301 WP_000107113.1.78339 WP_000107113.1.78366 WP_000107113.1.78372 WP_000107113.1.78383 WP_000107113.1.78407 WP_000107113.1.78443 WP_000107113.1.78495 WP_000107113.1.78496 WP_000107113.1.78501 WP_000107113.1.78602 WP_000107113.1.78603 WP_000107113.1.7861 WP_000107113.1.78618 WP_000107113.1.78632 WP_000107113.1.78658 WP_000107113.1.78697 WP_000107113.1.78735 WP_000107113.1.78738 WP_000107113.1.7877 WP_000107113.1.78771 WP_000107113.1.78802 WP_000107113.1.78815 WP_000107113.1.78830 WP_000107113.1.78835 WP_000107113.1.78838 WP_000107113.1.78862 WP_000107113.1.78871 WP_000107113.1.78874 WP_000107113.1.78896 WP_000107113.1.7891 WP_000107113.1.78913 WP_000107113.1.78918 WP_000107113.1.78930 WP_000107113.1.79011 WP_000107113.1.79032 WP_000107113.1.79081 WP_000107113.1.79099 WP_000107113.1.79140 WP_000107113.1.79151 WP_000107113.1.79167 WP_000107113.1.79189 WP_000107113.1.79203 WP_000107113.1.79235 WP_000107113.1.79289 WP_000107113.1.79297 WP_000107113.1.79335 WP_000107113.1.79370 WP_000107113.1.79427 WP_000107113.1.79462 WP_000107113.1.79466 WP_000107113.1.79472 WP_000107113.1.79490 WP_000107113.1.79495 WP_000107113.1.79529 WP_000107113.1.79580 WP_000107113.1.79586 WP_000107113.1.7964 WP_000107113.1.79642 WP_000107113.1.79645 WP_000107113.1.79659 WP_000107113.1.79668 WP_000107113.1.79708 WP_000107113.1.7972 WP_000107113.1.79734 WP_000107113.1.79757 WP_000107113.1.79778 WP_000107113.1.7979 WP_000107113.1.7982 WP_000107113.1.79832 WP_000107113.1.79845 WP_000107113.1.79867 WP_000107113.1.79892 WP_000107113.1.7991 WP_000107113.1.79914 WP_000107113.1.79929 WP_000107113.1.79934 WP_000107113.1.79942 WP_000107113.1.79945 WP_000107113.1.79951 WP_000107113.1.79966 WP_000107113.1.79974 WP_000107113.1.80077 WP_000107113.1.80137 WP_000107113.1.80149 WP_000107113.1.80182 WP_000107113.1.80229 WP_000107113.1.80236 WP_000107113.1.80249 WP_000107113.1.80250 WP_000107113.1.80254 WP_000107113.1.80293 WP_000107113.1.80296 WP_000107113.1.80307 WP_000107113.1.80366 WP_000107113.1.80380 WP_000107113.1.80441 WP_000107113.1.80443 WP_000107113.1.80448 WP_000107113.1.80479 WP_000107113.1.80480 WP_000107113.1.80529 WP_000107113.1.80542 WP_000107113.1.80609 WP_000107113.1.80629 WP_000107113.1.80638 WP_000107113.1.80651 WP_000107113.1.80667 WP_000107113.1.80674 WP_000107113.1.80707 WP_000107113.1.80725 WP_000107113.1.80750 WP_000107113.1.80760 WP_000107113.1.80780 WP_000107113.1.80819 WP_000107113.1.80827 WP_000107113.1.80831 WP_000107113.1.80840 WP_000107113.1.80850 WP_000107113.1.80857 WP_000107113.1.80874 WP_000107113.1.80876 WP_000107113.1.80881 WP_000107113.1.80913 WP_000107113.1.80927 WP_000107113.1.80939 WP_000107113.1.80959 WP_000107113.1.8096 WP_000107113.1.80973 WP_000107113.1.81037 WP_000107113.1.8106 WP_000107113.1.81067 WP_000107113.1.81069 WP_000107113.1.81107 WP_000107113.1.81110 WP_000107113.1.81149 WP_000107113.1.81175 WP_000107113.1.8119 WP_000107113.1.81197 WP_000107113.1.81225 WP_000107113.1.81231 WP_000107113.1.8127 WP_000107113.1.8130 WP_000107113.1.81302 WP_000107113.1.81305 WP_000107113.1.81320 WP_000107113.1.81321 WP_000107113.1.81328 WP_000107113.1.8134 WP_000107113.1.81354 WP_000107113.1.81388 WP_000107113.1.81409 WP_000107113.1.81410 WP_000107113.1.81425 WP_000107113.1.81455 WP_000107113.1.81472 WP_000107113.1.81504 WP_000107113.1.81528 WP_000107113.1.81548 WP_000107113.1.81667 WP_000107113.1.81668 WP_000107113.1.8168 WP_000107113.1.81735 WP_000107113.1.81743 WP_000107113.1.81746 WP_000107113.1.81750 WP_000107113.1.81760 WP_000107113.1.81768 WP_000107113.1.81785 WP_000107113.1.81795 WP_000107113.1.81902 WP_000107113.1.81965 WP_000107113.1.81974 WP_000107113.1.81977 WP_000107113.1.81995 WP_000107113.1.82037 WP_000107113.1.82099 WP_000107113.1.82141 WP_000107113.1.82149 WP_000107113.1.82192 WP_000107113.1.82232 WP_000107113.1.82258 WP_000107113.1.82269 WP_000107113.1.82337 WP_000107113.1.82347 WP_000107113.1.82352 WP_000107113.1.8236 WP_000107113.1.82369 WP_000107113.1.82395 WP_000107113.1.82401 WP_000107113.1.82420 WP_000107113.1.82434 WP_000107113.1.82464 WP_000107113.1.8247 WP_000107113.1.82479 WP_000107113.1.82503 WP_000107113.1.82515 WP_000107113.1.82529 WP_000107113.1.82530 WP_000107113.1.82569 WP_000107113.1.82570 WP_000107113.1.82584 WP_000107113.1.82636 WP_000107113.1.82637 WP_000107113.1.82648 WP_000107113.1.82676 WP_000107113.1.82761 WP_000107113.1.82763 WP_000107113.1.8282 WP_000107113.1.82841 WP_000107113.1.82843 WP_000107113.1.82867 WP_000107113.1.82886 WP_000107113.1.82895 WP_000107113.1.82899 WP_000107113.1.82908 WP_000107113.1.82944 WP_000107113.1.82946 WP_000107113.1.82956 WP_000107113.1.82992 WP_000107113.1.83005 WP_000107113.1.83006 WP_000107113.1.83061 WP_000107113.1.83092 WP_000107113.1.83119 WP_000107113.1.83128 WP_000107113.1.83139 WP_000107113.1.83163 WP_000107113.1.83204 WP_000107113.1.8322 WP_000107113.1.83221 WP_000107113.1.83247 WP_000107113.1.83252 WP_000107113.1.83301 WP_000107113.1.83305 WP_000107113.1.83331 WP_000107113.1.83356 WP_000107113.1.83360 WP_000107113.1.83365 WP_000107113.1.83378 WP_000107113.1.83382 WP_000107113.1.83388 WP_000107113.1.83407 WP_000107113.1.83413 WP_000107113.1.83491 WP_000107113.1.83510 WP_000107113.1.83516 WP_000107113.1.83523 WP_000107113.1.8354 WP_000107113.1.83558 WP_000107113.1.83598 WP_000107113.1.83650 WP_000107113.1.83651 WP_000107113.1.83710 WP_000107113.1.83721 WP_000107113.1.83739 WP_000107113.1.83759 WP_000107113.1.83760 WP_000107113.1.83854 WP_000107113.1.83897 WP_000107113.1.83960 WP_000107113.1.8399 WP_000107113.1.83995 WP_000107113.1.84000 WP_000107113.1.84001 WP_000107113.1.84011 WP_000107113.1.84031 WP_000107113.1.84075 WP_000107113.1.84077 WP_000107113.1.84083 WP_000107113.1.84086 WP_000107113.1.84100 WP_000107113.1.84103 WP_000107113.1.84106 WP_000107113.1.84154 WP_000107113.1.84168 WP_000107113.1.84179 WP_000107113.1.84229 WP_000107113.1.8425 WP_000107113.1.84283 WP_000107113.1.84291 WP_000107113.1.84355 WP_000107113.1.84359 WP_000107113.1.84392 WP_000107113.1.84397 WP_000107113.1.8441 WP_000107113.1.84461 WP_000107113.1.84475 WP_000107113.1.84497 WP_000107113.1.84515 WP_000107113.1.84532 WP_000107113.1.84572 WP_000107113.1.84598 WP_000107113.1.84659 WP_000107113.1.84683 WP_000107113.1.84693 WP_000107113.1.84711 WP_000107113.1.84745 WP_000107113.1.84876 WP_000107113.1.84899 WP_000107113.1.8497 WP_000107113.1.84983 WP_000107113.1.850 WP_000107113.1.85014 WP_000107113.1.85031 WP_000107113.1.85040 WP_000107113.1.85079 WP_000107113.1.85094 WP_000107113.1.85120 WP_000107113.1.85126 WP_000107113.1.85134 WP_000107113.1.85147 WP_000107113.1.85178 WP_000107113.1.85180 WP_000107113.1.85190 WP_000107113.1.85192 WP_000107113.1.85217 WP_000107113.1.8526 WP_000107113.1.85301 WP_000107113.1.8533 WP_000107113.1.85408 WP_000107113.1.85433 WP_000107113.1.85469 WP_000107113.1.85481 WP_000107113.1.85483 WP_000107113.1.8552 WP_000107113.1.85541 WP_000107113.1.8556 WP_000107113.1.85568 WP_000107113.1.85615 WP_000107113.1.85617 WP_000107113.1.85663 WP_000107113.1.85671 WP_000107113.1.85672 WP_000107113.1.85675 WP_000107113.1.85723 WP_000107113.1.85742 WP_000107113.1.85759 WP_000107113.1.85784 WP_000107113.1.85854 WP_000107113.1.85855 WP_000107113.1.85864 WP_000107113.1.85886 WP_000107113.1.85900 WP_000107113.1.85904 WP_000107113.1.8591 WP_000107113.1.85943 WP_000107113.1.85976 WP_000107113.1.85982 WP_000107113.1.86007 WP_000107113.1.86010 WP_000107113.1.86017 WP_000107113.1.86043 WP_000107113.1.86092 WP_000107113.1.86120 WP_000107113.1.86138 WP_000107113.1.86157 WP_000107113.1.86159 WP_000107113.1.8616 WP_000107113.1.86173 WP_000107113.1.86206 WP_000107113.1.86240 WP_000107113.1.86259 WP_000107113.1.86285 WP_000107113.1.86306 WP_000107113.1.86310 WP_000107113.1.86316 WP_000107113.1.86335 WP_000107113.1.86347 WP_000107113.1.86356 WP_000107113.1.86380 WP_000107113.1.86389 WP_000107113.1.86450 WP_000107113.1.86453 WP_000107113.1.86469 WP_000107113.1.8647 WP_000107113.1.86514 WP_000107113.1.86580 WP_000107113.1.86588 WP_000107113.1.86601 WP_000107113.1.86610 WP_000107113.1.86634 WP_000107113.1.86661 WP_000107113.1.86699 WP_000107113.1.8671 WP_000107113.1.8672 WP_000107113.1.86744 WP_000107113.1.8678 WP_000107113.1.86807 WP_000107113.1.86810 WP_000107113.1.8684 WP_000107113.1.86859 WP_000107113.1.86860 WP_000107113.1.86895 WP_000107113.1.86902 WP_000107113.1.86906 WP_000107113.1.86915 WP_000107113.1.86921 WP_000107113.1.86982 WP_000107113.1.87051 WP_000107113.1.87095 WP_000107113.1.87148 WP_000107113.1.87187 WP_000107113.1.87219 WP_000107113.1.8722 WP_000107113.1.87265 WP_000107113.1.87323 WP_000107113.1.87346 WP_000107113.1.8736 WP_000107113.1.87370 WP_000107113.1.87460 WP_000107113.1.87493 WP_000107113.1.87500 WP_000107113.1.87552 WP_000107113.1.87583 WP_000107113.1.87584 WP_000107113.1.87626 WP_000107113.1.8767 WP_000107113.1.87687 WP_000107113.1.87695 WP_000107113.1.87712 WP_000107113.1.87760 WP_000107113.1.87779 WP_000107113.1.87813 WP_000107113.1.87875 WP_000107113.1.87899 WP_000107113.1.87905 WP_000107113.1.8792 WP_000107113.1.87933 WP_000107113.1.87936 WP_000107113.1.87945 WP_000107113.1.87999 WP_000107113.1.88014 WP_000107113.1.88019 WP_000107113.1.88073 WP_000107113.1.8809 WP_000107113.1.88165 WP_000107113.1.88222 WP_000107113.1.88244 WP_000107113.1.88275 WP_000107113.1.88291 WP_000107113.1.88293 WP_000107113.1.88356 WP_000107113.1.8837 WP_000107113.1.88393 WP_000107113.1.88423 WP_000107113.1.88474 WP_000107113.1.88508 WP_000107113.1.88609 WP_000107113.1.88620 WP_000107113.1.88624 WP_000107113.1.88651 WP_000107113.1.88698 WP_000107113.1.88703 WP_000107113.1.88731 WP_000107113.1.88762 WP_000107113.1.88792 WP_000107113.1.88845 WP_000107113.1.88854 WP_000107113.1.88902 WP_000107113.1.8891 WP_000107113.1.88942 WP_000107113.1.88957 WP_000107113.1.88967 WP_000107113.1.88980 WP_000107113.1.88981 WP_000107113.1.88982 WP_000107113.1.88995 WP_000107113.1.88998 WP_000107113.1.89008 WP_000107113.1.89054 WP_000107113.1.89114 WP_000107113.1.89116 WP_000107113.1.89119 WP_000107113.1.89120 WP_000107113.1.89138 WP_000107113.1.89174 WP_000107113.1.89177 WP_000107113.1.89215 WP_000107113.1.89221 WP_000107113.1.89291 WP_000107113.1.89304 WP_000107113.1.89311 WP_000107113.1.89354 WP_000107113.1.89362 WP_000107113.1.89408 WP_000107113.1.89452 WP_000107113.1.89462 WP_000107113.1.89527 WP_000107113.1.89570 WP_000107113.1.89580 WP_000107113.1.89604 WP_000107113.1.89606 WP_000107113.1.8961 WP_000107113.1.89622 WP_000107113.1.89632 WP_000107113.1.89634 WP_000107113.1.89647 WP_000107113.1.89657 WP_000107113.1.89659 WP_000107113.1.89765 WP_000107113.1.89777 WP_000107113.1.89815 WP_000107113.1.89817 WP_000107113.1.89832 WP_000107113.1.89902 WP_000107113.1.89914 WP_000107113.1.89940 WP_000107113.1.8996 WP_000107113.1.89965 WP_000107113.1.89975 WP_000107113.1.9002 WP_000107113.1.90033 WP_000107113.1.90084 WP_000107113.1.90097 WP_000107113.1.90108 WP_000107113.1.90193 WP_000107113.1.90211 WP_000107113.1.90220 WP_000107113.1.90248 WP_000107113.1.90252 WP_000107113.1.90293 WP_000107113.1.90311 WP_000107113.1.90348 WP_000107113.1.90363 WP_000107113.1.90409 WP_000107113.1.90417 WP_000107113.1.90440 WP_000107113.1.90453 WP_000107113.1.90458 WP_000107113.1.90472 WP_000107113.1.90522 WP_000107113.1.90557 WP_000107113.1.90563 WP_000107113.1.90566 WP_000107113.1.90585 WP_000107113.1.90620 WP_000107113.1.90625 WP_000107113.1.9064 WP_000107113.1.90641 WP_000107113.1.90701 WP_000107113.1.90734 WP_000107113.1.90748 WP_000107113.1.90759 WP_000107113.1.90792 WP_000107113.1.90859 WP_000107113.1.90866 WP_000107113.1.90876 WP_000107113.1.90959 WP_000107113.1.90984 WP_000107113.1.91003 WP_000107113.1.91023 WP_000107113.1.91042 WP_000107113.1.91049 WP_000107113.1.91056 WP_000107113.1.91069 WP_000107113.1.91107 WP_000107113.1.91179 WP_000107113.1.91215 WP_000107113.1.91278 WP_000107113.1.9131 WP_000107113.1.91334 WP_000107113.1.9137 WP_000107113.1.91372 WP_000107113.1.91405 WP_000107113.1.91453 WP_000107113.1.91459 WP_000107113.1.91470 WP_000107113.1.91473 WP_000107113.1.91493 WP_000107113.1.91505 WP_000107113.1.91512 WP_000107113.1.91524 WP_000107113.1.91528 WP_000107113.1.91564 WP_000107113.1.91579 WP_000107113.1.91580 WP_000107113.1.91621 WP_000107113.1.91628 WP_000107113.1.91702 WP_000107113.1.91724 WP_000107113.1.91732 WP_000107113.1.91742 WP_000107113.1.91776 WP_000107113.1.91788 WP_000107113.1.91795 WP_000107113.1.91806 WP_000107113.1.91880 WP_000107113.1.91898 WP_000107113.1.91904 WP_000107113.1.92013 WP_000107113.1.92044 WP_000107113.1.92047 WP_000107113.1.92060 WP_000107113.1.92067 WP_000107113.1.92068 WP_000107113.1.92093 WP_000107113.1.92108 WP_000107113.1.92149 WP_000107113.1.92165 WP_000107113.1.92171 WP_000107113.1.92183 WP_000107113.1.92208 WP_000107113.1.92213 WP_000107113.1.9222 WP_000107113.1.92268 WP_000107113.1.92299 WP_000107113.1.92310 WP_000107113.1.92318 WP_000107113.1.92375 WP_000107113.1.92399 WP_000107113.1.92411 WP_000107113.1.92439 WP_000107113.1.92443 WP_000107113.1.92452 WP_000107113.1.92482 WP_000107113.1.92529 WP_000107113.1.92531 WP_000107113.1.92557 WP_000107113.1.92562 WP_000107113.1.92575 WP_000107113.1.92628 WP_000107113.1.92659 WP_000107113.1.92669 WP_000107113.1.92671 WP_000107113.1.92729 WP_000107113.1.92738 WP_000107113.1.92754 WP_000107113.1.92758 WP_000107113.1.92806 WP_000107113.1.92875 WP_000107113.1.92879 WP_000107113.1.92883 WP_000107113.1.92890 WP_000107113.1.92893 WP_000107113.1.92895 WP_000107113.1.92926 WP_000107113.1.92939 WP_000107113.1.92947 WP_000107113.1.92975 WP_000107113.1.92988 WP_000107113.1.93059 WP_000107113.1.93061 WP_000107113.1.93086 WP_000107113.1.93101 WP_000107113.1.93136 WP_000107113.1.93155 WP_000107113.1.93213 WP_000107113.1.93215 WP_000107113.1.93275 WP_000107113.1.93322 WP_000107113.1.93339 WP_000107113.1.93365 WP_000107113.1.93376 WP_000107113.1.93410 WP_000107113.1.93524 WP_000107113.1.93543 WP_000107113.1.93577 WP_000107113.1.93596 WP_000107113.1.93604 WP_000107113.1.93650 WP_000107113.1.93656 WP_000107113.1.93662 WP_000107113.1.93691 WP_000107113.1.937 WP_000107113.1.93705 WP_000107113.1.93741 WP_000107113.1.93761 WP_000107113.1.93767 WP_000107113.1.9380 WP_000107113.1.93803 WP_000107113.1.93804 WP_000107113.1.93809 WP_000107113.1.93837 WP_000107113.1.9389 WP_000107113.1.93937 WP_000107113.1.93956 WP_000107113.1.93994 WP_000107113.1.94039 WP_000107113.1.94064 WP_000107113.1.94070 WP_000107113.1.94072 WP_000107113.1.94132 WP_000107113.1.94162 WP_000107113.1.94167 WP_000107113.1.94168 WP_000107113.1.94181 WP_000107113.1.94198 WP_000107113.1.9432 WP_000107113.1.94352 WP_000107113.1.94354 WP_000107113.1.94379 WP_000107113.1.94380 WP_000107113.1.94383 WP_000107113.1.94412 WP_000107113.1.94458 WP_000107113.1.94473 WP_000107113.1.94557 WP_000107113.1.94562 WP_000107113.1.94565 WP_000107113.1.94584 WP_000107113.1.94598 WP_000107113.1.94649 WP_000107113.1.94655 WP_000107113.1.94669 WP_000107113.1.94674 WP_000107113.1.94722 WP_000107113.1.94785 WP_000107113.1.94796 WP_000107113.1.94798 WP_000107113.1.94817 WP_000107113.1.94835 WP_000107113.1.94849 WP_000107113.1.94862 WP_000107113.1.94947 WP_000107113.1.94959 WP_000107113.1.94967 WP_000107113.1.94971 WP_000107113.1.94982 WP_000107113.1.94983 WP_000107113.1.94987 WP_000107113.1.9503 WP_000107113.1.95051 WP_000107113.1.95085 WP_000107113.1.95094 WP_000107113.1.95121 WP_000107113.1.95136 WP_000107113.1.95152 WP_000107113.1.9516 WP_000107113.1.95171 WP_000107113.1.95235 WP_000107113.1.95248 WP_000107113.1.95249 WP_000107113.1.9527 WP_000107113.1.95277 WP_000107113.1.95282 WP_000107113.1.95289 WP_000107113.1.9530 WP_000107113.1.95320 WP_000107113.1.95388 WP_000107113.1.95404 WP_000107113.1.95456 WP_000107113.1.95465 WP_000107113.1.95546 WP_000107113.1.95558 WP_000107113.1.95579 WP_000107113.1.95607 WP_000107113.1.95630 WP_000107113.1.95641 WP_000107113.1.95670 WP_000107113.1.95691 WP_000107113.1.95701 WP_000107113.1.9574 WP_000107113.1.95744 WP_000107113.1.95805 WP_000107113.1.95826 WP_000107113.1.95840 WP_000107113.1.9586 WP_000107113.1.95866 WP_000107113.1.95911 WP_000107113.1.95939 WP_000107113.1.95940 WP_000107113.1.96004 WP_000107113.1.96045 WP_000107113.1.9609 WP_000107113.1.96107 WP_000107113.1.96141 WP_000107113.1.96162 WP_000107113.1.96190 WP_000107113.1.96203 WP_000107113.1.96206 WP_000107113.1.96317 WP_000107113.1.96335 WP_000107113.1.96340 WP_000107113.1.96343 WP_000107113.1.96380 WP_000107113.1.96429 WP_000107113.1.9644 WP_000107113.1.96469 WP_000107113.1.96490 WP_000107113.1.96497 WP_000107113.1.96500 WP_000107113.1.96521 WP_000107113.1.96533 WP_000107113.1.96537 WP_000107113.1.96555 WP_000107113.1.96563 WP_000107113.1.96584 WP_000107113.1.96588 WP_000107113.1.96590 WP_000107113.1.96600 WP_000107113.1.96640 WP_000107113.1.96662 WP_000107113.1.96732 WP_000107113.1.96735 WP_000107113.1.9674 WP_000107113.1.96758 WP_000107113.1.96771 WP_000107113.1.96798 WP_000107113.1.96810 WP_000107113.1.96876 WP_000107113.1.96890 WP_000107113.1.96902 WP_000107113.1.96917 WP_000107113.1.96993 WP_000107113.1.97015 WP_000107113.1.97043 WP_000107113.1.97047 WP_000107113.1.97089 WP_000107113.1.97103 WP_000107113.1.97109 WP_000107113.1.97143 WP_000107113.1.97145 WP_000107113.1.97185 WP_000107113.1.97190 WP_000107113.1.97224 WP_000107113.1.97260 WP_000107113.1.97297 WP_000107113.1.97318 WP_000107113.1.97322 WP_000107113.1.97328 WP_000107113.1.97337 WP_000107113.1.97368 WP_000107113.1.97369 WP_000107113.1.97413 WP_000107113.1.97477 WP_000107113.1.97480 WP_000107113.1.97487 WP_000107113.1.97534 WP_000107113.1.97594 WP_000107113.1.97597 WP_000107113.1.97613 WP_000107113.1.97620 WP_000107113.1.97626 WP_000107113.1.97628 WP_000107113.1.97631 WP_000107113.1.97691 WP_000107113.1.97693 WP_000107113.1.97704 WP_000107113.1.97727 WP_000107113.1.97732 WP_000107113.1.97736 WP_000107113.1.9775 WP_000107113.1.97768 WP_000107113.1.97772 WP_000107113.1.97800 WP_000107113.1.97846 WP_000107113.1.97873 WP_000107113.1.97907 WP_000107113.1.9793 WP_000107113.1.97981 WP_000107113.1.97983 WP_000107113.1.9799 WP_000107113.1.98006 WP_000107113.1.98019 WP_000107113.1.98022 WP_000107113.1.9805 WP_000107113.1.98107 WP_000107113.1.9811 WP_000107113.1.98110 WP_000107113.1.98119 WP_000107113.1.98146 WP_000107113.1.98170 WP_000107113.1.98201 WP_000107113.1.98219 WP_000107113.1.98236 WP_000107113.1.98250 WP_000107113.1.9826 WP_000107113.1.98314 WP_000107113.1.98392 WP_000107113.1.98402 WP_000107113.1.9841 WP_000107113.1.98438 WP_000107113.1.98440 WP_000107113.1.98446 WP_000107113.1.98472 WP_000107113.1.98483 WP_000107113.1.98495 WP_000107113.1.98513 WP_000107113.1.98531 WP_000107113.1.98551 WP_000107113.1.98570 WP_000107113.1.98577 WP_000107113.1.98627 WP_000107113.1.98634 WP_000107113.1.98677 WP_000107113.1.98760 WP_000107113.1.98843 WP_000107113.1.98899 WP_000107113.1.98931 WP_000107113.1.98947 WP_000107113.1.9899 WP_000107113.1.99040 WP_000107113.1.99057 WP_000107113.1.99071 WP_000107113.1.99072 WP_000107113.1.99097 WP_000107113.1.99098 WP_000107113.1.99107 WP_000107113.1.99184 WP_000107113.1.9919 WP_000107113.1.99197 WP_000107113.1.99215 WP_000107113.1.99219 WP_000107113.1.99255 WP_000107113.1.99276 WP_000107113.1.99327 WP_000107113.1.99339 WP_000107113.1.99370 WP_000107113.1.99426 WP_000107113.1.99456 WP_000107113.1.99490 WP_000107113.1.99493 WP_000107113.1.9954 WP_000107113.1.99577 WP_000107113.1.99626 WP_000107113.1.99637 WP_000107113.1.99646 WP_000107113.1.99657 WP_000107113.1.99660 WP_000107113.1.99712 WP_000107113.1.99725 WP_000107113.1.99783 WP_000107113.1.99813 WP_000107113.1.99824 WP_000107113.1.99858 WP_000107113.1.99889 WP_000107113.1.99924 WP_000107113.1.99961 gi|549480383|ref|YP_008614609.1| gi|525946287|ref|YP_008307415.1| gi|378446317|ref|YP_005233949.1| gi|549725532|ref|YP_008645722.1| ABAK02000001|CDS_2424137-2422797 ABAM02000001|CDS_3486404-3485064 ABAN01000004|CDS_97435-98775 ABAO01000025|CDS_13955-12615 ABEI01000005|CDS_149666-148326 ABEL01000005|CDS_139094-137754 ABEW01000002|CDS_452130-453470 ABFF01000007|CDS_80372-81712 ABFG01000005|CDS_105229-106569 ABFH02000001|CDS_2067768-2069108 AE006468|CDS_3111879-3110539 AE017220|CDS_3071586-3070246 AM933172|CDS_3000566-2999226 CP000886|CDS_3073024-3071684 CP001113|CDS_3096218-3094878 CP001120|CDS_3094518-3093178 CP001144|CDS_3159629-3158289 CP001363|CDS_3131689-3130349 FN424405|CDS_3103890-3102550 NZ_ACBF01000001|CDS_254694-253354 gi|378985553|ref|YP_005248709.1| gi|378451717|ref|YP_005239077.1| gi|161615888|ref|YP_001589853.1| gi|538363541|ref|YP_008506826.1| gi|194443896|ref|YP_002042211.1| gi|386592653|ref|YP_006089053.1| gi|198242129|ref|YP_002216934.1| gi|525814233|ref|YP_008244251.1| gi|525829196|ref|YP_008252244.1| gi|550902325|ref|YP_008671417.1| gi|482905525|ref|YP_007904085.1| 272994.SPAB_03681 321314.SC2900 423368.SNSL254_A3182 439851.SeD_A3280 454169.SeHA_C3166 550537.SEN2805 99287.STM2960 gi|62181470|ref|YP_217887.1| gi|207858226|ref|YP_002244877.1| gi|378700873|ref|YP_005182830.1| gi|526221361|ref|YP_008267166.1| gi|379702218|ref|YP_005243946.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]