SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 439855.EcSMS35_0269 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  439855.EcSMS35_0269
Domain Number - Region: 127-159
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0706
Family NfeD domain-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 439855.EcSMS35_0269
Sequence length 221
Comment (Escherichia coli SMS 3 5)
Sequence
MKNYLWLVALLPLLSGCESQAILVKKDDAYFAPPTTEAPPPADGRAGGVFETGYNWSLTA
DRRAYRVGDILTVILEESTQSSKQAKTNFGKSNTVDIGAPTIFGHTKDKLSGSIDANRDF
DGSATSQQQNSLRGEITVSVHAVQPNGILEIRGEKWLTLNQGDEYIRLSGLVRADDIQND
NSVSSQRIADARISYAGRGALSDANAAGWLTRLFNHPLFPI
Download sequence
Identical sequences A0A061KVJ5 A0A0E1SY46 B1LHR2 W8ZEQ0
gi|386617753|ref|YP_006137333.1| gi|556554267|ref|YP_008720335.1| 439855.EcSMS35_0269 WP_000800871.1.100014 WP_000800871.1.100227 WP_000800871.1.100281 WP_000800871.1.100304 WP_000800871.1.100474 WP_000800871.1.101087 WP_000800871.1.101110 WP_000800871.1.101148 WP_000800871.1.101399 WP_000800871.1.101586 WP_000800871.1.101727 WP_000800871.1.101855 WP_000800871.1.101932 WP_000800871.1.102104 WP_000800871.1.10573 WP_000800871.1.10842 WP_000800871.1.10849 WP_000800871.1.11315 WP_000800871.1.11607 WP_000800871.1.11612 WP_000800871.1.12151 WP_000800871.1.12679 WP_000800871.1.12917 WP_000800871.1.12956 WP_000800871.1.12976 WP_000800871.1.12991 WP_000800871.1.13117 WP_000800871.1.13934 WP_000800871.1.14538 WP_000800871.1.14581 WP_000800871.1.14807 WP_000800871.1.14963 WP_000800871.1.15020 WP_000800871.1.15654 WP_000800871.1.15863 WP_000800871.1.1604 WP_000800871.1.16067 WP_000800871.1.16396 WP_000800871.1.16807 WP_000800871.1.17014 WP_000800871.1.17206 WP_000800871.1.17889 WP_000800871.1.17925 WP_000800871.1.18024 WP_000800871.1.18348 WP_000800871.1.18394 WP_000800871.1.18556 WP_000800871.1.19153 WP_000800871.1.19547 WP_000800871.1.19593 WP_000800871.1.20224 WP_000800871.1.20238 WP_000800871.1.20741 WP_000800871.1.21152 WP_000800871.1.21236 WP_000800871.1.21266 WP_000800871.1.21378 WP_000800871.1.21455 WP_000800871.1.21537 WP_000800871.1.21652 WP_000800871.1.21773 WP_000800871.1.22161 WP_000800871.1.22203 WP_000800871.1.22272 WP_000800871.1.22280 WP_000800871.1.2242 WP_000800871.1.22464 WP_000800871.1.22576 WP_000800871.1.22824 WP_000800871.1.22917 WP_000800871.1.22993 WP_000800871.1.23109 WP_000800871.1.23330 WP_000800871.1.23522 WP_000800871.1.23724 WP_000800871.1.23840 WP_000800871.1.23890 WP_000800871.1.23985 WP_000800871.1.24088 WP_000800871.1.24127 WP_000800871.1.2449 WP_000800871.1.2469 WP_000800871.1.24773 WP_000800871.1.24906 WP_000800871.1.24979 WP_000800871.1.25380 WP_000800871.1.25420 WP_000800871.1.25446 WP_000800871.1.25480 WP_000800871.1.2567 WP_000800871.1.25701 WP_000800871.1.25869 WP_000800871.1.25873 WP_000800871.1.25895 WP_000800871.1.2597 WP_000800871.1.26131 WP_000800871.1.26175 WP_000800871.1.26189 WP_000800871.1.26304 WP_000800871.1.26950 WP_000800871.1.26987 WP_000800871.1.26995 WP_000800871.1.27043 WP_000800871.1.27091 WP_000800871.1.27188 WP_000800871.1.27401 WP_000800871.1.27861 WP_000800871.1.27913 WP_000800871.1.27998 WP_000800871.1.28026 WP_000800871.1.28156 WP_000800871.1.28349 WP_000800871.1.28461 WP_000800871.1.28476 WP_000800871.1.28742 WP_000800871.1.28829 WP_000800871.1.29164 WP_000800871.1.2926 WP_000800871.1.29443 WP_000800871.1.29603 WP_000800871.1.30063 WP_000800871.1.3018 WP_000800871.1.30239 WP_000800871.1.30298 WP_000800871.1.30665 WP_000800871.1.30867 WP_000800871.1.30879 WP_000800871.1.31017 WP_000800871.1.31422 WP_000800871.1.3147 WP_000800871.1.31511 WP_000800871.1.31557 WP_000800871.1.3201 WP_000800871.1.32021 WP_000800871.1.32432 WP_000800871.1.3259 WP_000800871.1.3269 WP_000800871.1.33303 WP_000800871.1.3344 WP_000800871.1.34121 WP_000800871.1.3460 WP_000800871.1.34683 WP_000800871.1.34875 WP_000800871.1.34887 WP_000800871.1.34931 WP_000800871.1.35007 WP_000800871.1.35198 WP_000800871.1.35627 WP_000800871.1.35963 WP_000800871.1.35987 WP_000800871.1.3600 WP_000800871.1.36405 WP_000800871.1.3643 WP_000800871.1.36699 WP_000800871.1.36761 WP_000800871.1.3697 WP_000800871.1.37103 WP_000800871.1.37226 WP_000800871.1.37306 WP_000800871.1.37312 WP_000800871.1.37342 WP_000800871.1.37423 WP_000800871.1.37544 WP_000800871.1.37550 WP_000800871.1.37962 WP_000800871.1.37998 WP_000800871.1.38000 WP_000800871.1.38080 WP_000800871.1.38185 WP_000800871.1.38300 WP_000800871.1.38561 WP_000800871.1.39232 WP_000800871.1.39289 WP_000800871.1.39377 WP_000800871.1.39401 WP_000800871.1.39713 WP_000800871.1.3980 WP_000800871.1.39809 WP_000800871.1.39867 WP_000800871.1.40107 WP_000800871.1.40300 WP_000800871.1.40345 WP_000800871.1.40360 WP_000800871.1.40560 WP_000800871.1.40636 WP_000800871.1.40657 WP_000800871.1.40660 WP_000800871.1.40715 WP_000800871.1.40842 WP_000800871.1.41453 WP_000800871.1.41482 WP_000800871.1.41822 WP_000800871.1.41990 WP_000800871.1.42191 WP_000800871.1.42601 WP_000800871.1.42638 WP_000800871.1.42991 WP_000800871.1.43027 WP_000800871.1.43278 WP_000800871.1.4343 WP_000800871.1.44263 WP_000800871.1.44324 WP_000800871.1.44784 WP_000800871.1.44836 WP_000800871.1.45405 WP_000800871.1.45536 WP_000800871.1.45627 WP_000800871.1.45676 WP_000800871.1.45793 WP_000800871.1.4583 WP_000800871.1.46164 WP_000800871.1.46291 WP_000800871.1.46806 WP_000800871.1.46994 WP_000800871.1.47124 WP_000800871.1.4725 WP_000800871.1.4783 WP_000800871.1.47935 WP_000800871.1.48051 WP_000800871.1.4826 WP_000800871.1.48265 WP_000800871.1.48317 WP_000800871.1.48469 WP_000800871.1.48827 WP_000800871.1.49347 WP_000800871.1.49521 WP_000800871.1.49594 WP_000800871.1.49615 WP_000800871.1.49625 WP_000800871.1.49783 WP_000800871.1.49884 WP_000800871.1.49972 WP_000800871.1.50058 WP_000800871.1.50585 WP_000800871.1.50690 WP_000800871.1.50947 WP_000800871.1.50988 WP_000800871.1.50990 WP_000800871.1.51170 WP_000800871.1.51180 WP_000800871.1.51190 WP_000800871.1.51211 WP_000800871.1.5124 WP_000800871.1.51300 WP_000800871.1.51392 WP_000800871.1.51596 WP_000800871.1.51690 WP_000800871.1.52048 WP_000800871.1.52098 WP_000800871.1.52631 WP_000800871.1.5391 WP_000800871.1.54051 WP_000800871.1.54095 WP_000800871.1.54313 WP_000800871.1.54418 WP_000800871.1.54439 WP_000800871.1.54993 WP_000800871.1.55149 WP_000800871.1.55507 WP_000800871.1.55563 WP_000800871.1.55981 WP_000800871.1.56033 WP_000800871.1.56040 WP_000800871.1.56047 WP_000800871.1.56139 WP_000800871.1.56142 WP_000800871.1.56278 WP_000800871.1.5632 WP_000800871.1.56338 WP_000800871.1.56402 WP_000800871.1.56457 WP_000800871.1.56821 WP_000800871.1.56933 WP_000800871.1.56936 WP_000800871.1.57202 WP_000800871.1.57451 WP_000800871.1.58094 WP_000800871.1.58248 WP_000800871.1.58552 WP_000800871.1.58609 WP_000800871.1.59073 WP_000800871.1.5942 WP_000800871.1.59426 WP_000800871.1.59572 WP_000800871.1.59579 WP_000800871.1.59660 WP_000800871.1.59745 WP_000800871.1.60133 WP_000800871.1.60235 WP_000800871.1.60350 WP_000800871.1.60373 WP_000800871.1.61245 WP_000800871.1.61445 WP_000800871.1.61739 WP_000800871.1.61835 WP_000800871.1.62102 WP_000800871.1.62262 WP_000800871.1.62454 WP_000800871.1.62780 WP_000800871.1.62788 WP_000800871.1.62885 WP_000800871.1.64053 WP_000800871.1.64110 WP_000800871.1.6431 WP_000800871.1.64417 WP_000800871.1.65114 WP_000800871.1.65240 WP_000800871.1.65286 WP_000800871.1.65606 WP_000800871.1.66017 WP_000800871.1.66044 WP_000800871.1.6618 WP_000800871.1.66376 WP_000800871.1.6698 WP_000800871.1.67047 WP_000800871.1.67153 WP_000800871.1.67174 WP_000800871.1.67258 WP_000800871.1.67427 WP_000800871.1.67464 WP_000800871.1.67606 WP_000800871.1.67737 WP_000800871.1.67990 WP_000800871.1.68177 WP_000800871.1.68279 WP_000800871.1.68362 WP_000800871.1.68524 WP_000800871.1.68572 WP_000800871.1.68632 WP_000800871.1.68795 WP_000800871.1.68847 WP_000800871.1.68942 WP_000800871.1.68995 WP_000800871.1.69341 WP_000800871.1.69643 WP_000800871.1.69716 WP_000800871.1.7001 WP_000800871.1.7050 WP_000800871.1.70686 WP_000800871.1.71139 WP_000800871.1.71294 WP_000800871.1.71311 WP_000800871.1.71563 WP_000800871.1.71732 WP_000800871.1.71855 WP_000800871.1.72028 WP_000800871.1.72212 WP_000800871.1.72237 WP_000800871.1.72359 WP_000800871.1.72388 WP_000800871.1.72551 WP_000800871.1.72700 WP_000800871.1.7281 WP_000800871.1.73215 WP_000800871.1.73291 WP_000800871.1.73333 WP_000800871.1.73344 WP_000800871.1.73486 WP_000800871.1.74549 WP_000800871.1.74765 WP_000800871.1.75367 WP_000800871.1.75419 WP_000800871.1.76030 WP_000800871.1.7613 WP_000800871.1.76469 WP_000800871.1.771 WP_000800871.1.77200 WP_000800871.1.77224 WP_000800871.1.7775 WP_000800871.1.7780 WP_000800871.1.78010 WP_000800871.1.78305 WP_000800871.1.78376 WP_000800871.1.78491 WP_000800871.1.78575 WP_000800871.1.78814 WP_000800871.1.78845 WP_000800871.1.78895 WP_000800871.1.79243 WP_000800871.1.79276 WP_000800871.1.79348 WP_000800871.1.79619 WP_000800871.1.7967 WP_000800871.1.79933 WP_000800871.1.79955 WP_000800871.1.79973 WP_000800871.1.80 WP_000800871.1.80026 WP_000800871.1.80096 WP_000800871.1.80392 WP_000800871.1.81032 WP_000800871.1.81056 WP_000800871.1.81120 WP_000800871.1.81141 WP_000800871.1.81588 WP_000800871.1.82106 WP_000800871.1.82123 WP_000800871.1.8255 WP_000800871.1.82747 WP_000800871.1.82816 WP_000800871.1.83059 WP_000800871.1.83118 WP_000800871.1.83144 WP_000800871.1.83253 WP_000800871.1.84059 WP_000800871.1.84215 WP_000800871.1.84316 WP_000800871.1.84464 WP_000800871.1.8447 WP_000800871.1.84531 WP_000800871.1.84639 WP_000800871.1.85138 WP_000800871.1.85329 WP_000800871.1.85384 WP_000800871.1.85556 WP_000800871.1.85623 WP_000800871.1.85781 WP_000800871.1.86227 WP_000800871.1.86234 WP_000800871.1.86673 WP_000800871.1.86727 WP_000800871.1.87043 WP_000800871.1.87074 WP_000800871.1.87371 WP_000800871.1.87443 WP_000800871.1.8778 WP_000800871.1.88119 WP_000800871.1.8822 WP_000800871.1.88336 WP_000800871.1.88499 WP_000800871.1.8855 WP_000800871.1.88752 WP_000800871.1.89203 WP_000800871.1.89879 WP_000800871.1.89917 WP_000800871.1.90050 WP_000800871.1.9087 WP_000800871.1.90988 WP_000800871.1.91143 WP_000800871.1.91182 WP_000800871.1.91354 WP_000800871.1.91515 WP_000800871.1.91954 WP_000800871.1.9199 WP_000800871.1.92276 WP_000800871.1.92305 WP_000800871.1.92384 WP_000800871.1.92638 WP_000800871.1.93017 WP_000800871.1.93138 WP_000800871.1.93464 WP_000800871.1.93922 WP_000800871.1.94028 WP_000800871.1.94417 WP_000800871.1.94727 WP_000800871.1.94892 WP_000800871.1.94997 WP_000800871.1.95105 WP_000800871.1.95329 WP_000800871.1.95366 WP_000800871.1.95378 WP_000800871.1.95428 WP_000800871.1.9566 WP_000800871.1.95666 WP_000800871.1.95783 WP_000800871.1.95929 WP_000800871.1.96145 WP_000800871.1.96223 WP_000800871.1.9671 WP_000800871.1.97147 WP_000800871.1.97226 WP_000800871.1.97677 WP_000800871.1.98633 WP_000800871.1.99307 WP_000800871.1.99498 gi|170682469|ref|YP_001742376.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]