SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 43989.cce_0953 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  43989.cce_0953
Domain Number 1 Region: 800-1190
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.4e-124
Family PFOR PP module 0.0000000222
Further Details:      
 
Domain Number 2 Region: 420-672
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.09e-81
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000432
Further Details:      
 
Domain Number 3 Region: 5-259
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.62e-71
Family PFOR Pyr module 0.0000000786
Further Details:      
 
Domain Number 4 Region: 260-418
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.28e-47
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000678
Further Details:      
 
Domain Number 5 Region: 669-845
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.15e-24
Family Ferredoxin domains from multidomain proteins 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 43989.cce_0953
Sequence length 1210
Comment (Cyanothece ATCC 51142)
Sequence
MNSKTYATIDGNEAVARVAYRLNEVIAIYPITPSSPMGEWADAWASIGQPNLWGTVPSIV
EMQSEGGAAGAIHGSLQTGSLTTTFTASQGLLLMIPNLYKIAGELTATVIHVAARSLAAQ
ALSIFGDHGDVMAARSTGLALIASASVQEAQDFAAITTAASYESRVAGLHFFDGFRTSHE
VQKVELLDDTVLRSLIKDEWVIAHRQRALTPDRPVIRGTAQNPDVYFQARETVNPFYAAY
PDILQKTMDKFAQLTGREYKLYEYHGDPEAEKVIILMGSGCETVHETVDYLISQGEKVGV
LKVRLYRPFAAEKLIKTLPKTVKKIAVLDRTKEPGSAGEPLYVDVVTGFMECCEEMPLPK
IVGGRYGLSSKEFTSAMVKGVFDNLALDNPKNHFTIGIKDDLSHTSIDYDPNFSTEPDNV
VRAIFYGLGSDGTVGANKNSIKIIGEETNNYAQGYFVYDSKKSGSVTVSHLRFGPNPIKS
TYLVTKANFIACHQWEFLEKFDLLEPAIEGSIFLINSPYQPEYVWQQLPRPVQEHIINKN
INVYVINAYEVARNAGMGGRINTVMQVCFFALANVLPREEAIEQIKKYIRKTYGKKGEDI
VQMNIKAVDAALDHLHQVTIPNSIDDNAPDIAHPIPDTAPAFIRDVLGKMMARQGEDIPV
SALPCDGTYPSGTAKWEKRNVAQEIPVWDEDVCVQCGKCVLVCPHAVIRSKVYEEAALSN
APESFKSADAKDLDWKKTELKFTIQVAAEDCTGCGVCVDVCPAKNKSQPKLKAINMAPQL
PIREQERENWDYFLSIANPDRNTLKLNKISHQQMQEPLFEFSGACAGCGETPYIKLATQL
FGDRMVVANATGCSSIYGGNLPTTPWTHNQEGRGPAWSNSLFEDNAEFGLGFRVSIDKQT
EFATELVKSLASDIGETLATGILNAQQKDEADIFEQRERVAFLKQRLTQLSNGNLEETTQ
AKVTMLQSVADYLVKKSVWIIGGDGWAYDIGYGGLDHVLASGRNVNILVMDTEVYSNTGG
QASKATPRAAVAKFASGGKPSPKKDLGLMAMTYGNVYVASVAMGAKNEHSIKAFLEAEAY
EGVSLIIAYSHCIAHGINMTTAMSYQKDIVDSGRWLLYRYHPDLVGEGKNPLQLDMRSPK
LPIERTMYQENRFKMLARSKPDAAKKLLKQAQEDVNTRWQMYQYLAARQLEMGNGNGHSK
GNIETETTVN
Download sequence
Identical sequences B1WSX4
WP_009547149.1.18909 WP_009547149.1.94124 43989.cce_0953 gi|172035869|ref|YP_001802370.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]