SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 43989.cce_3605 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  43989.cce_3605
Domain Number - Region: 96-143
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00209
Family NfeD domain-like 0.01
Further Details:      
 
Domain Number - Region: 12-84
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.034
Family LacY-like proton/sugar symporter 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 43989.cce_3605
Sequence length 153
Comment (Cyanothece ATCC 51142)
Sequence
MSFSYVPMVSPALLWLIAGAILCFFEAIFPVAFVAFMMGISAILVAAIALVISSFPVQVI
LWLALSTISIVVSRRFVPKKNPLNSLVGDAQEGETLTEITPGKIGRVLYEGNSWQAICAD
DTISISPHQKVYIVTRKGNTLVVLPEFLPSSIE
Download sequence
Identical sequences B1X0R4
WP_009545233.1.18909 WP_009545233.1.94124 gi|172038518|ref|YP_001805019.1| 43989.cce_3605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]