SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 43989.cce_5179 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  43989.cce_5179
Domain Number 1 Region: 138-423
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.8e-124
Family Enolase 0.0000000296
Further Details:      
 
Domain Number 2 Region: 1-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.65e-54
Family Enolase N-terminal domain-like 0.00000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 43989.cce_5179
Sequence length 424
Comment (Cyanothece ATCC 51142)
Sequence
MKIKTIIASEMLDSRGNPTVEAQVTLEDGTTGSALVPSGASTGEKEAVELRDEDPNRYGG
KGVIKAVDNVNNHLAPALVGMDITEQRAIDETMIAIDSTPNKANMGANAILAVSLAAART
AANYLKMPLYRYMGGTNASLLPVPCMNVINGGVHADNTIDFQEFMIAPHNAPNFAEAIRM
GTETFHTLKGLLKKKGLSTGIGDEGGFAPNLKSNEDAIEFIIEAIEAAGYKPGEDISICL
DPATAELWKDGKYIFFKSDQSTKTPSEMVELWQDWVNKYPIVSLEDGMGENDWEGWKLLT
DAIGDKVELVGDDLFCTNAKILQQGIDAKIANSVLIKVNQIGSLTETLDTIELAQKNNYK
CFVSHRSGETEDTTIADLVVATGAGQIKTGSGCRGERIAKFNQLLRIERHLGKTARFAGK
SAFA
Download sequence
Identical sequences B1X314
43989.cce_5179 WP_009547552.1.18909 WP_009547552.1.94124 gi|172055264|ref|YP_001806591.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]