SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 441620.Mpop_4140 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  441620.Mpop_4140
Domain Number 1 Region: 281-427
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.06e-22
Family Histidine kinase 0.0024
Further Details:      
 
Domain Number 2 Region: 209-290
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000000051
Family Homodimeric domain of signal transducing histidine kinase 0.0034
Further Details:      
 
Weak hits

Sequence:  441620.Mpop_4140
Domain Number - Region: 113-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0811
Family NfeD domain-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 441620.Mpop_4140
Sequence length 438
Comment (Methylobacterium populi BJ001)
Sequence
MRSLRVRLFAILVLATGLIWLSAVAWIYLGSKREVEQVLDNRLQEAARMVSSLVGAVGSA
GPDGAPRTFPAPTAYERQLSCQIWSLDGRMVARSTGAPERRLTDAPAGFSQREVDGETWR
VFTVEDAERGVRVMVGDRLGLRERLVTDLIMGLVTPAILMVPLLGMLIWASLGRGLRPLR
LMARDLAGRGADDMSAIDTNRTPAEVRPLADALNGLFLKVESARRHEREVTAFAAHELRT
PLAGLKVQAQVAMAATDPDVAKAALRQILAAVDRTTRLVRQLLDAAQLDAAGEAPSLAEV
DVGALVTETVEGMRTPPGVRTQIDPGLRGYTLLADPEGLRLAVRNLHENAVQHMVTGTVA
WGARPHGEGIVVRDEGPGIPEEELPHVTTRFFRGRHKSETGSGLGLAIAEMASRRSGLSL
RLRNRTDRPGLEAEILPG
Download sequence
Identical sequences A0A0L6J2D7 A0A177I8F4 B1ZCK6 H1KDD3
WP_003596994.1.1114 WP_003596994.1.27762 WP_003596994.1.47287 WP_003596994.1.71917 WP_003596994.1.72001 WP_003596994.1.78039 441620.Mpop_4140 gi|188583345|ref|YP_001926790.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]