SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 441768.ACL_0402 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  441768.ACL_0402
Domain Number 1 Region: 138-429
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.27e-130
Family Enolase 0.00000000417
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.52e-56
Family Enolase N-terminal domain-like 0.00000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 441768.ACL_0402
Sequence length 431
Comment (Acholeplasma laidlawii PG 8A)
Sequence
MPFITSVYAREVLDSRGNPTVEVEIVTDSGAFGRTLVPSGASTGEHEAVELRDGDKSRYL
GKGVLKAVENVNDIIGPAILGDSVLDQVALDRKLIALDGTKNKGKLGANAILGVSIAAAK
AAADLLNLELYQYLGGFNAKQLPVPMMNIINGGAHSDAPIDFQEFMIFPVGAPSFKEAIR
WGAEIFHALKAILKKKGLSTAVGDEGGFAPNLASNEDTIDNILEAIKNAGYKAGEEVFIG
FDVAASEFFDKAKGKYVFKKSTKEEFTSAELVEYYAGLVQKYPIISIEDGMDENDWDGWK
LLTDKLGSKIQLVGDDLFVTNTEYLARGIKTNTANSILVKVNQIGTLTETFDAIEMAKRA
GYTAVISHRSGETEDTTIADIAVAANTGQIKTGSASRTDRVAKYNQLMRIEDQLGEDAVY
LGKDSFYNLKK
Download sequence
Identical sequences A0A2G7QL42 A9NF93
441768.ACL_0402 ABX81023 WP_012242354.1.15573 WP_012242354.1.20474 WP_012242354.1.46366 WP_012242354.1.71135 WP_012242354.1.72193 WP_012242354.1.92431 gi|162447267|ref|YP_001620399.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]