SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 441771.CLC_1673 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  441771.CLC_1673
Domain Number 1 Region: 24-120
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 9.42e-20
Family Pentapeptide repeats 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 441771.CLC_1673
Sequence length 233
Comment (Clostridium botulinum A Hall)
Sequence
MRKLSQEEFKEILKNRNPKERLVLKEIELFDMDFTSWNLSNIDFSLSAFHRVKFDEANLE
YSSVFNVLFDECTVRKANFRHANLECAVLRYVDMTGCNIEGANLYAAVLEYAKLDDIIFD
EDTKWFHLHCPEKGAFLAYKKCFNNRLVQLLIPADAKRTSATLPSCRCNKAKVLTIKSFD
YKESYMEAWSLVDENFVYRVGEWVEVKDFNEDRWMDSTTGIHFWMTREEAKNY
Download sequence
Identical sequences A5I2B6
gi|153932507|ref|YP_001383986.1| gi|148379607|ref|YP_001254148.1| gi|153934609|ref|YP_001387530.1| WP_011986287.1.63111 YP_001254148.1.75347 YP_001387530.1.17653 413999.CBO1647 441770.CLB_1664 441771.CLC_1673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]