SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 441771.CLC_2234 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  441771.CLC_2234
Domain Number - Region: 169-227
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000484
Family NfeD domain-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 441771.CLC_2234
Sequence length 234
Comment (Clostridium botulinum A Hall)
Sequence
MEIKNHIMDQKEVYIKIGYSNDDAEKAAIKDMGDPKATGKMLDSVHPPTIDWIQIIALIM
ITLTLQVLKILSELGGSNFSSIAPIDILRILGIFLSVYALIWIGIEKYSDLPFFYGKSQR
GGSNANGVFICSLAIVMMSHSLLQTIIFLLIFAPIIAIERSIIESKRIKKEQKFLWQQGI
AYEDFNYKGKAIFNNSPRKVYSQNEPIKKGDPIIITKIDGFNLVVEKQDLHNNN
Download sequence
Identical sequences 441770.CLB_2251 441771.CLC_2234 gi|153931579|ref|YP_001384562.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]