SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 441772.CLI_0295 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  441772.CLI_0295
Domain Number 1 Region: 141-428
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.5e-132
Family Enolase 0.00000000884
Further Details:      
 
Domain Number 2 Region: 6-141
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.92e-57
Family Enolase N-terminal domain-like 0.00000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 441772.CLI_0295
Sequence length 431
Comment (Clostridium botulinum F Langeland)
Sequence
MKNYIEIVDVYARQILDSRCNPTVEVEVELEDGTVGVAAVPSGASTGAFEAVELRDGDKS
KYLGKGVLKAVDNVNTIIADELVGMNVLDQVAIDKTMIELDGTDNKAKLGANAMLGVSLA
CAKAAANSLGMSLYQYIGGVNAKVLPVPMMNIINGGKHADNNVDLQEFMIMPAGAPSFSE
ALRMCSEVYHALKSTLKSQGYDTGVGDEGGFAPNLKSNEEAIVVIIEAIKEAGYTPGKDI
FIALDPASSEIFEDGKYNLAGEGRVLTPEEMANYYVELAEKYPIISIEDGMAEEDWDGWK
ILTEKIGNKVQLVGDDLFVTNTERLSKGIKLGVANSILIKLNQIGTLTETLNAIEMAERA
GYTAVVSHRSGETEDTTIADLVVAVNAGQIKTGAPARSERVAKYNQLLRIEEELNDMGEY
RGLKAFYNINK
Download sequence
Identical sequences A0A175MCT4 A0A1V9IKE1 A7G9Y3 B1IDB9
gi|153939129|ref|YP_001389593.1| gi|384460672|ref|YP_005673267.1| 441772.CLI_0295 498213.CLD_0545 gi|170757014|ref|YP_001779861.1| WP_003399038.1.100585 WP_003399038.1.17118 WP_003399038.1.19081 WP_003399038.1.21789 WP_003399038.1.24613 WP_003399038.1.49536 WP_003399038.1.49610 WP_003399038.1.49637 WP_003399038.1.53136 WP_003399038.1.63039 WP_003399038.1.68062 WP_003399038.1.74799 WP_003399038.1.82254 WP_003399038.1.96435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]