SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 443144.GM21_0192 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  443144.GM21_0192
Domain Number 1 Region: 801-1181
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.84e-131
Family PFOR PP module 0.0000000178
Further Details:      
 
Domain Number 2 Region: 424-675
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.88e-81
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000563
Further Details:      
 
Domain Number 3 Region: 4-258
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.41e-73
Family PFOR Pyr module 0.0000000504
Further Details:      
 
Domain Number 4 Region: 260-419
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.43e-46
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000837
Further Details:      
 
Domain Number 5 Region: 672-844
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 4.05e-19
Family Ferredoxin domains from multidomain proteins 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 443144.GM21_0192
Sequence length 1183
Comment (Geobacter M21)
Sequence
MSRRMVTIDGNTAAAHVAHATNEVIAIYPITPSSVMGEISDEKSAKGEKNIWGTVPSVSE
LQSEGGASGAVHGALQAGALTTTFTASQGLLLMIPNMFKIAGELTSTVFHISARAISAAA
LNIFGDHSDVMAARATGWGMLCSNNVQEVMDFALISQAATLRARVPFMHYFDGFRTSHEV
QKVEELSFDDMRAMIDDDLVQAHRLRALTPDRPVMRGTAQNPDVYFQGRETVNAYYPAAL
KIVQEEMDKFAGITGRKYSVTEYFGAPDAERVVIVMGSAADTVQETIETLAAQGEKVGLV
KVRLFRPFPVDALAACLPASVKKIAVLDRTKEPGSLGEPLYLDVRTAIGEAMADGKTSFK
NYPIIVGGRFGLGSKEFTPGMAKGVFDNLKADKPKNHFVVGIKEDVTNSSLDFDKSFVNP
SAGTYAAMFYGLGSDGTVGANKNSIKIIGEKTDNNVQAYFVYDSKKAGSVTTSHLRFGKG
AIRSPYLIDQADFIACHNFSFLEKYDMLTNAKKGGTFLLCSPFDKEQVWDSMPVEVQQQI
IDKKLKFYVINAIALGEKLGLGARINVIMQTAFFKISNIMPLDTALDAIKDAIKKSYGKS
GDKVVDMNNKAVDAALENIFEVNVPAKATSALRKPPVVGAHAPKFVQEVTAQLIAGYGDD
VPVSMIPADGTFPTATSQYEKRNIAVDIPVWDEQLCIQCGICSFVCPHASIRMKVYDADK
LSGAPATFKSADARGNEFKGMKCTVQVAPEDCTGCAACVANCPAKSKEDANKKAINMQFQ
APLRATEAANYDFFLAMPETDPKLVKLETLKGSQLARPLFEYSGACAGCGETPYLKLMSQ
LFGDRAMIANATGCTSIYGGNLPTTPWAKNADGRGPAWSNSLFEDNAEFGFGMRLAVDKF
NQAATELLDVVSLPADLVAEIKGADQQTQAGVEAQRARVAKLKDTLAGSKDAAAKKLLSI
ADYLVKKSVWIVGGDGWAYDIGYGGLDHVIASGKNVNLLVLDTEVYSNTGGQASKSTPMG
AVAQFAAGGKPQAKKDLAMIAMAYGNVYVAKVALSNPAQVVKAFIEAEAYNGPSLILAYS
HCIAHGIDMATAVETQKRAVASGHWPLVRYNPDLAEQGKNPLQLDSKDPSISLEEYAYGE
NRYRVLKKSNPEAAATLMARSSELTARRFDLYKRMAEMDFENK
Download sequence
Identical sequences C6E8Y8
WP_012773904.1.50895 gi|253698846|ref|YP_003020035.1| 443144.GM21_0192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]