SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 443144.GM21_0296 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  443144.GM21_0296
Domain Number 1 Region: 77-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000248
Family NfeD domain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 443144.GM21_0296
Sequence length 152
Comment (Geobacter M21)
Sequence
MDIVWWHWLTLGLILIGLELIVPSFTIIWFGLGAVIVSIVIALFPSFPFSAQILVWTVAS
SLSTFAWFRFFNARRDQTKAGSSKGAVIGETGLVIRAAQQYAKGAVKFHLPLMGADEWAC
VADEPLAVGDRVRVVDVEGHVMKVEKISKGDK
Download sequence
Identical sequences C6DYA5
443144.GM21_0296 gi|253698949|ref|YP_003020138.1| WP_012774007.1.50895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]