SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 443144.GM21_1177 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  443144.GM21_1177
Domain Number 1 Region: 1-180
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 6.8e-47
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 443144.GM21_1177
Sequence length 183
Comment (Geobacter M21)
Sequence
MRKDVLIAGFGGQGVLLAGNLLSYAAIEEGKNVSYFPAYGVEKRGGSATCTVVIADGAVG
SPVVGQPSILVVLNQASLERFGARVRPGGICIVNSSLVDVSALGRDDIRIITVPMNDIAT
ELGDPRMVNMVALGAYAAVSGAVQLATLAGALKEALPERNHKYIPANVKAIETGARIALE
KTA
Download sequence
Identical sequences C6E365
WP_015836493.1.50895 gi|253699807|ref|YP_003020996.1| 443144.GM21_1177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]