SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 443144.GM21_3060 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  443144.GM21_3060
Domain Number 1 Region: 7-187
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.32e-30
Family Clp protease, ClpP subunit 0.067
Further Details:      
 
Domain Number 2 Region: 359-425
Classification Level Classification E-value
Superfamily NfeD domain-like 1.83e-16
Family NfeD domain-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 443144.GM21_3060
Sequence length 430
Comment (Geobacter M21)
Sequence
MRLFLPALLVLGLLLPMLLFGEQPQVAVISVRGPINPVTSGYLKQSLEAAGKRGDRLLLV
ELDTPGGLDTAMRDAVQAIFASPVPVAVYVTPSGARAASAGAVIGLSADILAMAPGTNIG
AAHPVGLGGEKQDKVMASKIVNDAEAYVDGIAKKRGRNVELARRMVRDSISLTSEAALKQ
GVIDLVAADRQELLAKLEGRKVLRGGKEEVLHLSGARVTSYEMGTRDKILDAISNPDVAY
MLMLLGMLGLFFELSNPGVILPGVIGGISLLLSFFALQTLPVNYAGIALILLAIVLFIAE
VKVVSYGMLAVGGIVSMVLGSLMLFPSPEPYLRLSWSVIILTVLATAGFFTVVVAKVMQA
HREKPITGVEGMLGEEGVADSDIDPEGRVLVRGEYWNAVSGETIRAGERVRVVEVKGLHL
RVETIGKEKV
Download sequence
Identical sequences C6E396
WP_015838305.1.50895 gi|253701657|ref|YP_003022846.1| 443144.GM21_3060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]