SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 444157.Tneu_0131 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  444157.Tneu_0131
Domain Number 1 Region: 235-494
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.89e-55
Family PFOR Pyr module 0.022
Further Details:      
 
Domain Number 2 Region: 510-615
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000000000012
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.058
Further Details:      
 
Domain Number 3 Region: 3-253
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000000575
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 444157.Tneu_0131
Sequence length 625
Comment (Thermoproteus neutrophilus V24Sta)
Sequence
MELSFLIGGPQGRGVETASLIFIYGVGSAGYYVYARREFWSNIAGGRHSYVVGTISDRWP
APAPGNRVALALALDGQAVLEHVFHLERGAVLVYNTEEEERDPGSYIMMARPQAERLARF
AKDRGFEPTVGGFVKYLRENGVETVGVPYGKALREIGGKIGVTSPVLLSRFLNTFVVALG
AALLGLDAEYVARGVGYALGKKPDVVEQNKRIAQEAMRLVDRRIATLAPRRPPERRIFWN
GNEAASYGKIVAGVRLLAYYPITPATDDAMTFERSIPFPVADGRAGAVVLQTEDELAAVA
VATGGAIAGARAATVTSGPGFSLMAEAVSMAGMMEVGVVVVVWMRAGPSTGQATRQGQQD
LLYALFTGHGEYPKIVYSSGDLEEAFLDSIRAANWAERYRVPVVHLLDKNLSNTFAVMPL
PNPDAVKIERPPPAVYTAPSEAEAYPLDKTVPPRLLPGISNAVFHLSSLEHDAAGDPEED
AEAVAKMYERRMAKMALIEEEIPPEERAVYFGPEDARDVVVGWGSVKPAVLTALRELKDV
GFLYVKMLYPYPRDVVRRFLEGRSALFIENNYMAQLALVTRMFTGLEPAAVAVKFNGRPV
TADDVVEAYKRFKEGRRRVVIESDL
Download sequence
Identical sequences B1YAB4
gi|171184615|ref|YP_001793534.1| 444157.Tneu_0131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]