SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 444157.Tneu_0308 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  444157.Tneu_0308
Domain Number 1 Region: 13-167
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.39e-21
Family Clp protease, ClpP subunit 0.055
Further Details:      
 
Domain Number 2 Region: 324-385
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000379
Family NfeD domain-like 0.0029
Further Details:      
 
Weak hits

Sequence:  444157.Tneu_0308
Domain Number - Region: 195-316
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0262
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 444157.Tneu_0308
Sequence length 386
Comment (Thermoproteus neutrophilus V24Sta)
Sequence
MRALLALVLLAAAAYAMQAVVVKLDGTIDGTAVTLVERGLEAAEARGLPLVLVIDTPGGF
LLPMEKIVKLVESARVPVYAYVPDAARAASAGAFIALAAERLYMAPTAVIGAAQPRPPDP
KVVNYAAAKMRALAARRWNDTRVQLAESFVTENKALTGAEAVAAGIAEPPPPIEPAAVVE
RDPLLRLLNALSDPALLVAMLIAGAALILYEVATSGFQGLGVIGGVAVVSALYLLGELGI
SWLAAALALAAAVLIIAEAHLGHGAAALAGAALGAAAVVAAYWGQPYVGLSALGATAAGL
SIAAGIALAYVAWRVRRSLSRRPQSLRDVVGARGVAKTALGPGRRGVVYAAGEDWTAESV
EGEVQPGEEVEVVDVEGLVLKVKKVK
Download sequence
Identical sequences B1YBC8
gi|171184786|ref|YP_001793705.1| 444157.Tneu_0308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]