SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 444157.Tneu_1529 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  444157.Tneu_1529
Domain Number 1 Region: 1-172
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.28e-40
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 444157.Tneu_1529
Sequence length 177
Comment (Thermoproteus neutrophilus V24Sta)
Sequence
MYEVIFIGRGGQGAVTAAQLLAYVAALEGKQAQALPEFGAERRGAVVKAYLRIGEPPLHS
SMKKADYVVVLDGRIVDQIDVRQYGKPNAVYIVNTKREASWYIAIDATSIAIKHGLVVAG
WPVVNLIMAAAFAAVSGAVSLEGILRALPEFVPRRYVDANRNAVVEAFNLMKLAKAR
Download sequence
Identical sequences B1Y9M4
444157.Tneu_1529 gi|171185980|ref|YP_001794899.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]