SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 444177.Bsph_1513 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  444177.Bsph_1513
Domain Number 1 Region: 111-360
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.83e-65
Family D-glucarate dehydratase-like 0.0000128
Further Details:      
 
Domain Number 2 Region: 2-124
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.07e-34
Family Enolase N-terminal domain-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 444177.Bsph_1513
Sequence length 367
Comment (Lysinibacillus sphaericus C3 41)
Sequence
MIKKVEVFAARLQLKEPFVISYVHLDDMPTILTRIETDKGVVGWGEAVPDQNVTGETWES
TYHVIKHVLAPLLINEDPFAVERIHKKFNEKIDGVPSAKAALDIALYDLMGKITGQPVYQ
LIGGKAHKELQVPRVISIKSPEEMAKDASEFVASGFRNIKIKVGTNAELDIARIRAVREA
IGDEVQLRVDANQGWNRMETLKVIRETIACHVDWYEQPVKAHDLRALKEIRALSPCSIMV
DEGVHNIYDLVDVIEMRAADMLNIKLMKSGGIYPALALASLAEAAEMPCQVGSMVESAIA
TMAGAHLAISKSIIHTNEMVGPLMFVKDVANVTYDKDILQLSHKAGLGIEVDEQYVKEIT
CFSCEIK
Download sequence
Identical sequences B1HQG6 W7S8L8
444177.Bsph_1513 gi|169827085|ref|YP_001697243.1| WP_012293230.1.18114 WP_012293230.1.47961 WP_012293230.1.54975 WP_012293230.1.60952 WP_012293230.1.93816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]