SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 444177.Bsph_3721 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  444177.Bsph_3721
Domain Number 1 Region: 14-176
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.69e-21
Family Clp protease, ClpP subunit 0.052
Further Details:      
 
Weak hits

Sequence:  444177.Bsph_3721
Domain Number - Region: 363-422
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00183
Family NfeD domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 444177.Bsph_3721
Sequence length 428
Comment (Lysinibacillus sphaericus C3 41)
Sequence
MTFLLAFPLTSAFASSKVYHVPIHNEVERGLHAFLERAFNEAKENNAKAIILDIHTPGGF
VNAASDIAMLMDATDIWTIAFINKDAHSAGAFLALHADEIYMVPNGTIGAAAVIDSAGNT
ADLKANSAWLAQMSAAAETSGRDPKYALAMADSNYELPEYRAEGKNLLTLSASEALKVKY
SEGTVKNFQELLEKKDLQDRDVVSIEPTFSEKLARFITNPIIVPILLSIASLGLVMELYS
PGFGVPGIMGLSALGLFFFGHMVAGFAGYESLLLLIIGLALVVAEFFVPGGIVGILGGVL
IILSLLLAGANIMQMIIAILIALVIAIIGMVILMKFFGKKLHVLNRLVLMDATTTEEGYV
SNVNRTELLGKVGTTLTPLRPAGTMVLDSERIDVVSEGGYVDANKHVEIIKVEGSRIVVR
QTKKEMEE
Download sequence
Identical sequences B1HTK1
gi|169829177|ref|YP_001699335.1| 444177.Bsph_3721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]