SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 444450.ECH74115_1971 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  444450.ECH74115_1971
Domain Number 1 Region: 116-310
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.19e-51
Family D-glucarate dehydratase-like 0.00000000966
Further Details:      
 
Domain Number 2 Region: 3-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.07e-33
Family Enolase N-terminal domain-like 0.000000759
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 444450.ECH74115_1971
Sequence length 321
Comment (Escherichia coli O157 H7 EC4115)
Sequence
MRTVKVFEEAWPLHTPFVIARGSRSEARVVVVELEEEGIKGTGECTPYPRYGESDASVMA
QIMSVVPQLEKGLTREELQKILPAGAARNALDCALWDLAARKQQQSLADLIGITLPETVI
TAQTVVIGTPDQMANSASTLWQAGAKLLKVKLDNHLISERMVAIRTAVPDTTLIVDANES
WHAEGLAARCQLLADLGVAMLEQPLPAQDDAALENFIHPLPICADESCHTRSNLKALKGR
YEMVNIKLDKTGGLTEALALATEARAQGFSLMLGCMLCTSRAISAALPLVPQVSFADLDG
PTWLAVDVEPALQFTTGELHL
Download sequence
Identical sequences A0A0F6C3S1 A0A0F6F5V9 A0A0H3PQ46 A0A152V4U6 A0A1Z3V430
386585.ECs1904 444450.ECH74115_1971 544404.ECSP_1850 gi|387882385|ref|YP_006312687.1| gi|209399075|ref|YP_002270385.1| gi|38703962|ref|NP_309931.2| gi|254792918|ref|YP_003077755.1| NP_309931.2.58667 WP_001302124.1.10001 WP_001302124.1.100073 WP_001302124.1.10010 WP_001302124.1.100299 WP_001302124.1.100302 WP_001302124.1.100508 WP_001302124.1.100554 WP_001302124.1.100925 WP_001302124.1.101105 WP_001302124.1.101166 WP_001302124.1.101206 WP_001302124.1.101628 WP_001302124.1.10206 WP_001302124.1.102094 WP_001302124.1.102139 WP_001302124.1.10273 WP_001302124.1.10335 WP_001302124.1.10476 WP_001302124.1.10761 WP_001302124.1.10970 WP_001302124.1.1111 WP_001302124.1.11240 WP_001302124.1.11301 WP_001302124.1.11420 WP_001302124.1.11671 WP_001302124.1.11690 WP_001302124.1.12259 WP_001302124.1.12305 WP_001302124.1.12552 WP_001302124.1.13060 WP_001302124.1.13217 WP_001302124.1.13223 WP_001302124.1.13332 WP_001302124.1.13348 WP_001302124.1.13430 WP_001302124.1.13442 WP_001302124.1.13481 WP_001302124.1.13881 WP_001302124.1.13936 WP_001302124.1.13939 WP_001302124.1.14110 WP_001302124.1.14453 WP_001302124.1.14621 WP_001302124.1.14748 WP_001302124.1.15356 WP_001302124.1.15503 WP_001302124.1.15527 WP_001302124.1.1559 WP_001302124.1.15626 WP_001302124.1.15702 WP_001302124.1.15782 WP_001302124.1.16075 WP_001302124.1.16133 WP_001302124.1.16222 WP_001302124.1.16272 WP_001302124.1.16463 WP_001302124.1.16481 WP_001302124.1.16845 WP_001302124.1.17187 WP_001302124.1.1731 WP_001302124.1.17415 WP_001302124.1.17515 WP_001302124.1.17904 WP_001302124.1.18136 WP_001302124.1.18326 WP_001302124.1.1834 WP_001302124.1.18340 WP_001302124.1.1881 WP_001302124.1.18837 WP_001302124.1.18995 WP_001302124.1.19039 WP_001302124.1.191 WP_001302124.1.19140 WP_001302124.1.19350 WP_001302124.1.19840 WP_001302124.1.19847 WP_001302124.1.2005 WP_001302124.1.20449 WP_001302124.1.20480 WP_001302124.1.20546 WP_001302124.1.20594 WP_001302124.1.20745 WP_001302124.1.20893 WP_001302124.1.20941 WP_001302124.1.20950 WP_001302124.1.20989 WP_001302124.1.21508 WP_001302124.1.21666 WP_001302124.1.21668 WP_001302124.1.21962 WP_001302124.1.2218 WP_001302124.1.22251 WP_001302124.1.22304 WP_001302124.1.22381 WP_001302124.1.22594 WP_001302124.1.22743 WP_001302124.1.22925 WP_001302124.1.23073 WP_001302124.1.23115 WP_001302124.1.23241 WP_001302124.1.23323 WP_001302124.1.23355 WP_001302124.1.23467 WP_001302124.1.23790 WP_001302124.1.23806 WP_001302124.1.23838 WP_001302124.1.2388 WP_001302124.1.23895 WP_001302124.1.23899 WP_001302124.1.23973 WP_001302124.1.23984 WP_001302124.1.24070 WP_001302124.1.24283 WP_001302124.1.24341 WP_001302124.1.24753 WP_001302124.1.24870 WP_001302124.1.25076 WP_001302124.1.25082 WP_001302124.1.25088 WP_001302124.1.25201 WP_001302124.1.25305 WP_001302124.1.25526 WP_001302124.1.25577 WP_001302124.1.25794 WP_001302124.1.25819 WP_001302124.1.25831 WP_001302124.1.26066 WP_001302124.1.26105 WP_001302124.1.26121 WP_001302124.1.26134 WP_001302124.1.26246 WP_001302124.1.26474 WP_001302124.1.26525 WP_001302124.1.26761 WP_001302124.1.26878 WP_001302124.1.26975 WP_001302124.1.26998 WP_001302124.1.27338 WP_001302124.1.27445 WP_001302124.1.28143 WP_001302124.1.28551 WP_001302124.1.28734 WP_001302124.1.28879 WP_001302124.1.291 WP_001302124.1.29126 WP_001302124.1.29404 WP_001302124.1.29564 WP_001302124.1.29597 WP_001302124.1.29618 WP_001302124.1.2978 WP_001302124.1.29818 WP_001302124.1.29976 WP_001302124.1.30 WP_001302124.1.30019 WP_001302124.1.30052 WP_001302124.1.30064 WP_001302124.1.30164 WP_001302124.1.30476 WP_001302124.1.30637 WP_001302124.1.30918 WP_001302124.1.30993 WP_001302124.1.30999 WP_001302124.1.31055 WP_001302124.1.312 WP_001302124.1.31252 WP_001302124.1.3140 WP_001302124.1.31401 WP_001302124.1.31575 WP_001302124.1.31715 WP_001302124.1.31956 WP_001302124.1.32063 WP_001302124.1.32243 WP_001302124.1.32536 WP_001302124.1.32574 WP_001302124.1.32590 WP_001302124.1.32888 WP_001302124.1.32931 WP_001302124.1.33049 WP_001302124.1.33055 WP_001302124.1.33094 WP_001302124.1.33125 WP_001302124.1.33146 WP_001302124.1.33167 WP_001302124.1.33178 WP_001302124.1.33268 WP_001302124.1.33981 WP_001302124.1.34269 WP_001302124.1.34383 WP_001302124.1.34500 WP_001302124.1.34680 WP_001302124.1.34686 WP_001302124.1.35393 WP_001302124.1.3550 WP_001302124.1.36010 WP_001302124.1.36212 WP_001302124.1.36626 WP_001302124.1.36767 WP_001302124.1.37102 WP_001302124.1.37337 WP_001302124.1.37372 WP_001302124.1.3762 WP_001302124.1.37731 WP_001302124.1.37769 WP_001302124.1.3795 WP_001302124.1.38050 WP_001302124.1.38063 WP_001302124.1.38107 WP_001302124.1.38306 WP_001302124.1.38369 WP_001302124.1.389 WP_001302124.1.38958 WP_001302124.1.39180 WP_001302124.1.39268 WP_001302124.1.39310 WP_001302124.1.39415 WP_001302124.1.39564 WP_001302124.1.39601 WP_001302124.1.39646 WP_001302124.1.39820 WP_001302124.1.40113 WP_001302124.1.40234 WP_001302124.1.4030 WP_001302124.1.40549 WP_001302124.1.40629 WP_001302124.1.40742 WP_001302124.1.40758 WP_001302124.1.40793 WP_001302124.1.40882 WP_001302124.1.40900 WP_001302124.1.40952 WP_001302124.1.4103 WP_001302124.1.41060 WP_001302124.1.41294 WP_001302124.1.41330 WP_001302124.1.41478 WP_001302124.1.41536 WP_001302124.1.41734 WP_001302124.1.41849 WP_001302124.1.42036 WP_001302124.1.4213 WP_001302124.1.42447 WP_001302124.1.4250 WP_001302124.1.42513 WP_001302124.1.42594 WP_001302124.1.4261 WP_001302124.1.42863 WP_001302124.1.42975 WP_001302124.1.43013 WP_001302124.1.43079 WP_001302124.1.43121 WP_001302124.1.4313 WP_001302124.1.43140 WP_001302124.1.43196 WP_001302124.1.43384 WP_001302124.1.43448 WP_001302124.1.43469 WP_001302124.1.43536 WP_001302124.1.43754 WP_001302124.1.43798 WP_001302124.1.43816 WP_001302124.1.43837 WP_001302124.1.43911 WP_001302124.1.43939 WP_001302124.1.44125 WP_001302124.1.44165 WP_001302124.1.44389 WP_001302124.1.44488 WP_001302124.1.44561 WP_001302124.1.44733 WP_001302124.1.44906 WP_001302124.1.44954 WP_001302124.1.45020 WP_001302124.1.45076 WP_001302124.1.45153 WP_001302124.1.45195 WP_001302124.1.45293 WP_001302124.1.45575 WP_001302124.1.45707 WP_001302124.1.45841 WP_001302124.1.45901 WP_001302124.1.45941 WP_001302124.1.46039 WP_001302124.1.4619 WP_001302124.1.46282 WP_001302124.1.46283 WP_001302124.1.46369 WP_001302124.1.46414 WP_001302124.1.46451 WP_001302124.1.46503 WP_001302124.1.46597 WP_001302124.1.46611 WP_001302124.1.46626 WP_001302124.1.46810 WP_001302124.1.46832 WP_001302124.1.46913 WP_001302124.1.4708 WP_001302124.1.47140 WP_001302124.1.4723 WP_001302124.1.47411 WP_001302124.1.47784 WP_001302124.1.47827 WP_001302124.1.47884 WP_001302124.1.47954 WP_001302124.1.47994 WP_001302124.1.48065 WP_001302124.1.4812 WP_001302124.1.48176 WP_001302124.1.48226 WP_001302124.1.48258 WP_001302124.1.48697 WP_001302124.1.48712 WP_001302124.1.48792 WP_001302124.1.48806 WP_001302124.1.4931 WP_001302124.1.49332 WP_001302124.1.49401 WP_001302124.1.49464 WP_001302124.1.49496 WP_001302124.1.49567 WP_001302124.1.49655 WP_001302124.1.49771 WP_001302124.1.5003 WP_001302124.1.50110 WP_001302124.1.50345 WP_001302124.1.50358 WP_001302124.1.5037 WP_001302124.1.50380 WP_001302124.1.50549 WP_001302124.1.50762 WP_001302124.1.50986 WP_001302124.1.51154 WP_001302124.1.51171 WP_001302124.1.51505 WP_001302124.1.51643 WP_001302124.1.51693 WP_001302124.1.51834 WP_001302124.1.52039 WP_001302124.1.5217 WP_001302124.1.52496 WP_001302124.1.52543 WP_001302124.1.52883 WP_001302124.1.52933 WP_001302124.1.53084 WP_001302124.1.53181 WP_001302124.1.53211 WP_001302124.1.53252 WP_001302124.1.53270 WP_001302124.1.54024 WP_001302124.1.54213 WP_001302124.1.5441 WP_001302124.1.54454 WP_001302124.1.5467 WP_001302124.1.54883 WP_001302124.1.55218 WP_001302124.1.55820 WP_001302124.1.55838 WP_001302124.1.55892 WP_001302124.1.55897 WP_001302124.1.56072 WP_001302124.1.5639 WP_001302124.1.56392 WP_001302124.1.56481 WP_001302124.1.56489 WP_001302124.1.56491 WP_001302124.1.56554 WP_001302124.1.56571 WP_001302124.1.57032 WP_001302124.1.57071 WP_001302124.1.57180 WP_001302124.1.57197 WP_001302124.1.57280 WP_001302124.1.57453 WP_001302124.1.57466 WP_001302124.1.57610 WP_001302124.1.5764 WP_001302124.1.57646 WP_001302124.1.57836 WP_001302124.1.58048 WP_001302124.1.58057 WP_001302124.1.58169 WP_001302124.1.58238 WP_001302124.1.584 WP_001302124.1.58423 WP_001302124.1.5852 WP_001302124.1.58707 WP_001302124.1.58723 WP_001302124.1.59038 WP_001302124.1.59359 WP_001302124.1.59374 WP_001302124.1.59470 WP_001302124.1.59491 WP_001302124.1.59679 WP_001302124.1.59733 WP_001302124.1.59838 WP_001302124.1.59905 WP_001302124.1.59931 WP_001302124.1.59959 WP_001302124.1.60042 WP_001302124.1.60043 WP_001302124.1.60117 WP_001302124.1.60304 WP_001302124.1.60461 WP_001302124.1.60613 WP_001302124.1.60647 WP_001302124.1.60744 WP_001302124.1.60761 WP_001302124.1.60872 WP_001302124.1.61039 WP_001302124.1.61099 WP_001302124.1.61108 WP_001302124.1.61186 WP_001302124.1.61253 WP_001302124.1.61623 WP_001302124.1.618 WP_001302124.1.61874 WP_001302124.1.62135 WP_001302124.1.62182 WP_001302124.1.62480 WP_001302124.1.6261 WP_001302124.1.62675 WP_001302124.1.62888 WP_001302124.1.6331 WP_001302124.1.63445 WP_001302124.1.63563 WP_001302124.1.63586 WP_001302124.1.63615 WP_001302124.1.6364 WP_001302124.1.63872 WP_001302124.1.63957 WP_001302124.1.64086 WP_001302124.1.64161 WP_001302124.1.64371 WP_001302124.1.6445 WP_001302124.1.64621 WP_001302124.1.64946 WP_001302124.1.65035 WP_001302124.1.65084 WP_001302124.1.65118 WP_001302124.1.65194 WP_001302124.1.65372 WP_001302124.1.65546 WP_001302124.1.6587 WP_001302124.1.65875 WP_001302124.1.65898 WP_001302124.1.65963 WP_001302124.1.65978 WP_001302124.1.66033 WP_001302124.1.66100 WP_001302124.1.66531 WP_001302124.1.66566 WP_001302124.1.66873 WP_001302124.1.66922 WP_001302124.1.67073 WP_001302124.1.67136 WP_001302124.1.67150 WP_001302124.1.67214 WP_001302124.1.67446 WP_001302124.1.67533 WP_001302124.1.67676 WP_001302124.1.6769 WP_001302124.1.67726 WP_001302124.1.67753 WP_001302124.1.67775 WP_001302124.1.67780 WP_001302124.1.68096 WP_001302124.1.68411 WP_001302124.1.68493 WP_001302124.1.68523 WP_001302124.1.6880 WP_001302124.1.6887 WP_001302124.1.68936 WP_001302124.1.69054 WP_001302124.1.69350 WP_001302124.1.69351 WP_001302124.1.69780 WP_001302124.1.69810 WP_001302124.1.69818 WP_001302124.1.69896 WP_001302124.1.70123 WP_001302124.1.70125 WP_001302124.1.70517 WP_001302124.1.70539 WP_001302124.1.70576 WP_001302124.1.70713 WP_001302124.1.70723 WP_001302124.1.70787 WP_001302124.1.71003 WP_001302124.1.71099 WP_001302124.1.71205 WP_001302124.1.71225 WP_001302124.1.71226 WP_001302124.1.71269 WP_001302124.1.71423 WP_001302124.1.71448 WP_001302124.1.71840 WP_001302124.1.72016 WP_001302124.1.72180 WP_001302124.1.72322 WP_001302124.1.72427 WP_001302124.1.72614 WP_001302124.1.72641 WP_001302124.1.7291 WP_001302124.1.72913 WP_001302124.1.73126 WP_001302124.1.73343 WP_001302124.1.73626 WP_001302124.1.73785 WP_001302124.1.73801 WP_001302124.1.7392 WP_001302124.1.73934 WP_001302124.1.73968 WP_001302124.1.7429 WP_001302124.1.7446 WP_001302124.1.74521 WP_001302124.1.74536 WP_001302124.1.74557 WP_001302124.1.74828 WP_001302124.1.74904 WP_001302124.1.75164 WP_001302124.1.75248 WP_001302124.1.7539 WP_001302124.1.75507 WP_001302124.1.75536 WP_001302124.1.75577 WP_001302124.1.75694 WP_001302124.1.7583 WP_001302124.1.75989 WP_001302124.1.76054 WP_001302124.1.7608 WP_001302124.1.76152 WP_001302124.1.76189 WP_001302124.1.76407 WP_001302124.1.76477 WP_001302124.1.76697 WP_001302124.1.76827 WP_001302124.1.77099 WP_001302124.1.77128 WP_001302124.1.77239 WP_001302124.1.77275 WP_001302124.1.77392 WP_001302124.1.77644 WP_001302124.1.77707 WP_001302124.1.77760 WP_001302124.1.77961 WP_001302124.1.77979 WP_001302124.1.7799 WP_001302124.1.78063 WP_001302124.1.784 WP_001302124.1.7855 WP_001302124.1.78593 WP_001302124.1.78611 WP_001302124.1.79172 WP_001302124.1.7940 WP_001302124.1.79528 WP_001302124.1.79563 WP_001302124.1.79576 WP_001302124.1.79715 WP_001302124.1.79965 WP_001302124.1.80309 WP_001302124.1.80330 WP_001302124.1.80578 WP_001302124.1.80606 WP_001302124.1.81070 WP_001302124.1.81273 WP_001302124.1.81420 WP_001302124.1.81442 WP_001302124.1.81514 WP_001302124.1.81754 WP_001302124.1.81821 WP_001302124.1.81873 WP_001302124.1.81934 WP_001302124.1.81975 WP_001302124.1.82010 WP_001302124.1.82057 WP_001302124.1.82296 WP_001302124.1.82594 WP_001302124.1.82629 WP_001302124.1.8268 WP_001302124.1.82797 WP_001302124.1.82820 WP_001302124.1.83099 WP_001302124.1.83712 WP_001302124.1.84219 WP_001302124.1.84264 WP_001302124.1.84312 WP_001302124.1.84482 WP_001302124.1.84635 WP_001302124.1.84657 WP_001302124.1.8477 WP_001302124.1.85253 WP_001302124.1.85558 WP_001302124.1.85722 WP_001302124.1.85772 WP_001302124.1.86171 WP_001302124.1.86225 WP_001302124.1.86255 WP_001302124.1.86340 WP_001302124.1.86574 WP_001302124.1.86994 WP_001302124.1.87076 WP_001302124.1.87247 WP_001302124.1.87254 WP_001302124.1.87382 WP_001302124.1.87616 WP_001302124.1.88197 WP_001302124.1.8843 WP_001302124.1.88524 WP_001302124.1.88528 WP_001302124.1.88803 WP_001302124.1.88891 WP_001302124.1.89322 WP_001302124.1.89385 WP_001302124.1.89405 WP_001302124.1.89569 WP_001302124.1.89988 WP_001302124.1.90139 WP_001302124.1.90219 WP_001302124.1.90257 WP_001302124.1.90342 WP_001302124.1.90837 WP_001302124.1.90848 WP_001302124.1.90967 WP_001302124.1.9098 WP_001302124.1.91072 WP_001302124.1.91153 WP_001302124.1.91288 WP_001302124.1.91356 WP_001302124.1.91384 WP_001302124.1.91548 WP_001302124.1.91651 WP_001302124.1.9168 WP_001302124.1.91801 WP_001302124.1.91871 WP_001302124.1.92819 WP_001302124.1.93027 WP_001302124.1.93069 WP_001302124.1.93427 WP_001302124.1.93428 WP_001302124.1.93601 WP_001302124.1.93630 WP_001302124.1.93670 WP_001302124.1.93695 WP_001302124.1.93821 WP_001302124.1.94213 WP_001302124.1.9426 WP_001302124.1.94302 WP_001302124.1.94343 WP_001302124.1.94544 WP_001302124.1.94589 WP_001302124.1.94676 WP_001302124.1.94790 WP_001302124.1.94991 WP_001302124.1.95011 WP_001302124.1.95028 WP_001302124.1.95035 WP_001302124.1.95129 WP_001302124.1.95834 WP_001302124.1.9616 WP_001302124.1.96425 WP_001302124.1.96725 WP_001302124.1.96796 WP_001302124.1.97193 WP_001302124.1.9729 WP_001302124.1.9740 WP_001302124.1.97402 WP_001302124.1.97513 WP_001302124.1.97632 WP_001302124.1.9770 WP_001302124.1.97789 WP_001302124.1.97871 WP_001302124.1.98046 WP_001302124.1.98083 WP_001302124.1.981 WP_001302124.1.98155 WP_001302124.1.98176 WP_001302124.1.98187 WP_001302124.1.98205 WP_001302124.1.98279 WP_001302124.1.98312 WP_001302124.1.98384 WP_001302124.1.98543 WP_001302124.1.98569 WP_001302124.1.9883 WP_001302124.1.98920 WP_001302124.1.99101 WP_001302124.1.99234 WP_001302124.1.99487 WP_001302124.1.99501 WP_001302124.1.99692 WP_001302124.1.99986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]