SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 445932.Emin_0361 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  445932.Emin_0361
Domain Number 1 Region: 77-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000222
Family NfeD domain-like 0.0039
Further Details:      
 
Weak hits

Sequence:  445932.Emin_0361
Domain Number - Region: 24-75
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0102
Family LacY-like proton/sugar symporter 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 445932.Emin_0361
Sequence length 141
Comment (Elusimicrobium minutum Pei191)
Sequence
MSIHYIWLIAGLLFIIGEMFTLDFSLACIGTALLVTALPAYFGASFLIQAVFFAVIAIIL
FLTVRPIALKYLHKNQSVKTNVDALIGKQAHVTEEINAEKKTGRVKIDGDVWQAVSDSVI
ALDADVTVEKIEGIILTVKKI
Download sequence
Identical sequences B2KB97
445932.Emin_0361 WP_012414534.1.71589 gi|187250774|ref|YP_001875256.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]