SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 446462.Amir_0394 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  446462.Amir_0394
Domain Number 1 Region: 218-464
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.75e-68
Family D-glucarate dehydratase-like 0.0000000221
Further Details:      
 
Domain Number 2 Region: 39-173
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.19e-35
Family Enolase N-terminal domain-like 0.0000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 446462.Amir_0394
Sequence length 470
Comment (Actinosynnema mirum DSM 43827)
Sequence
MPTPEPGAPATEPAAPPATRKITVPGGAAPPAAIPPAATITAVDVVDVRFPTSRELDGSD
AMNPDPDYSAAYVVLRTDSGPEGHGLVFTIGRGNDVQAAAIRALAPHVVGRPVPEDAAAL
AALSADLVGDSQIRWLGPEKGVAHMAVGAVVNAAWDLASRRAGLPLWRFLSGMSPEELVG
LVDFRYLTDALTPDEALTLLRDAQPGRSTRAEELQRCGYPAYTTSPGWLGYPDDKLADLA
ARAVADGFDMIKLKVGADLSDDIRRMGLARSVVGPSVRIAVDANQRWDVGAAIGWVRELA
PFDPYWVEEPTSPDDVLGHRAIAEAVAPVRVATGEHVANRVVFKQLLQAGAVDVVQLDAC
RVGGVGELLAILLLARKFGVPVCPHAGGVGLCELVRHLAMVDYVAVSGSLDGRVLEWVDH
LHEHFTDPAVVRDGRYLAPTAPGFSAQLKESSVRDHRYPDGPVWAGTGER
Download sequence
Identical sequences C6WGP5
446462.Amir_0394 gi|256374547|ref|YP_003098207.1| WP_012783024.1.52053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]