SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 446462.Amir_2578 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  446462.Amir_2578
Domain Number - Region: 264-292
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0549
Family NfeD domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 446462.Amir_2578
Sequence length 420
Comment (Actinosynnema mirum DSM 43827)
Sequence
MAEHGTEHDAEFAPPGRRLPEATRDAALLRLREGMAESPRRVPAAAAVVGALALVGAGLA
GALVGELRTDLGTAGSSEPPSPVQELLMPDSNQRYRVETGPSSEEPVCRPEGDGIPPVEG
WTRLVTGQHLGVVVTVYDTPAGVLFCERTPKSTSWTGPVADPGSLAVAFTTANGTIAGFT
GADERPFGLFDGQGSAYPARAGRIFLAPAEFRPGSGLVAQYEVRDSAEVQVEEPLTPPAV
AERRLLADAGAGTPWTCRNGRAPLVDPEFWTAGPDVPVRVGESVQIARMGELLAVCSPDD
APSAHEPLLEEGNLSPGRVRGGGVIGVTVFHSFTSELNPESGLVQTESTSRALVGLVLDG
RVTSVELVTPGAPPVAAVVSGGSFVLVSELLAVDDRGAASAELVTRDASGREVGRVVAPV
Download sequence
Identical sequences C6WMI6
WP_015801404.1.52053 gi|256376701|ref|YP_003100361.1| 446462.Amir_2578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]