SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 446462.Amir_3420 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  446462.Amir_3420
Domain Number 1 Region: 76-140
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000772
Family NfeD domain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 446462.Amir_3420
Sequence length 143
Comment (Actinosynnema mirum DSM 43827)
Sequence
MGFVPALIWMILGVLLIAAEVLSGDFVLVMLGAAALGAAGAAGLGADLVVSALVFSALSL
GLVAGVRPVLKRRLDKGLGHRSGVEALLGGTAVVVSTVDGHGGRVRIGGEVWSARSMDHA
VLEPGAEVTVVEISGATAVVLGT
Download sequence
Identical sequences C6W9V1
gi|256377504|ref|YP_003101164.1| WP_015802206.1.52053 446462.Amir_3420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]