SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 446462.Amir_5910 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  446462.Amir_5910
Domain Number 1 Region: 58-88,173-269
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 4.58e-41
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00017
Further Details:      
 
Domain Number 2 Region: 3-56
Classification Level Classification E-value
Superfamily UBA-like 3.32e-16
Family TS-N domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 446462.Amir_5910
Sequence length 271
Comment (Actinosynnema mirum DSM 43827)
Sequence
MANYTAADVKRLRELTAAGMMDCKKALEEADGDFDKAIEILRIKGAKDVAKRAERTTANG
LVAAEGGVMVELRCETDFVAKNSDFQDLAAKVIAVAKATRPADVEVLKATELDGKTVDAV
VQEFSAKIGEKLELAKVAVFDGAVTTYLHRRSADLPPAVGVVVEYTGDNEDAARGVCMQI
AAMSPRYLTRDEVPADIVANERDIAEKTSREEGKPEAALPKIVEGRVNGFFKDVVLLEQA
SVTESKKTVKAVLDEAGVTVTRFARFEVGQA
Download sequence
Identical sequences C6WEU4
WP_015804604.1.52053 446462.Amir_5910 gi|256379905|ref|YP_003103565.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]