SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 446465.Bfae_03930 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  446465.Bfae_03930
Domain Number 1 Region: 125-375
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.57e-61
Family D-glucarate dehydratase-like 0.0000196
Further Details:      
 
Domain Number 2 Region: 18-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.89e-23
Family Enolase N-terminal domain-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 446465.Bfae_03930
Sequence length 380
Comment (Brachybacterium faecium DSM 4810)
Sequence
MSPDPSLPDPGTNSLHVVAVRTHRHRAPLRRPFITAARRTESVEYVVAEVVLDDGTIGQG
SAAETLAVTGESADTIRAALEGPLRRAVLGENASITDLSARVAGALDGATSAKAALEVAL
HDAWARAAGHPLVELLGGRLEDGLMNDMTISLEEPGVMARRAREAVAAGEQILKIKLGHD
IAVDRERLAAVIEAAPSARLRLDANQGWSPEQAIEIITGFEADALPIDLVEQPVAAGDVE
GLARVSAAVSLPIMADEAVWDVEDARRLVDRGACDLLNIKLAKTGGLRGALAIADVARAA
GIECMLGAMMEPRISITAAAHLAIAHPAITMIDLDPPAWFASDVPRGGYVQDGAWLRLTG
GAGTGLELLEARVDRAGGER
Download sequence
Identical sequences C7MGS5
gi|257067601|ref|YP_003153856.1| YP_003153856.1.138 446465.Bfae_03930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]