SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 446471.Xcel_0457 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  446471.Xcel_0457
Domain Number 1 Region: 71-304
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.3e-48
Family D-glucarate dehydratase-like 0.00056
Further Details:      
 
Weak hits

Sequence:  446471.Xcel_0457
Domain Number - Region: 14-52
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 0.0441
Family Enolase N-terminal domain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 446471.Xcel_0457
Sequence length 349
Comment (Xylanimonas cellulosilytica DSM 15894)
Sequence
MSRGPVSSPVVWSTPLRTRFRGLDSRDGLLLRGEAGWGELSPFWDYDDVESSTWLRCARE
AAELGWPTPRRATVPVNVTVPAVGPDRARALVLASGGCRTAKVKVAQRSTSSGAVHGPRG
ELEPLAAEVERVAAVRAALDELYGPGVGRIRVDANGGWTVDQAVTHLRALDDAAGGLEYA
EQPCATVEELAAVRRRLDVPIAADESIRRAADPLRVVALDAADVVVLKVQPLGGVRACLE
LAERVGLPVVVSSALESSVGLAAGVALAAALPELPYACGLATSQLLVHDVVADPLLPVDG
ALPVLAAGDPRLAPDAAALAEATPTDQVRADWLARAARLGDLLAAEVVR
Download sequence
Identical sequences D1BVZ3
WP_012877240.1.53538 446471.Xcel_0457 gi|269955265|ref|YP_003325054.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]